Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BTLA AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Horse, Human BTLA Polyclonal Antibody | anti-BTLA antibody

BTLA antibody - C-terminal region

Gene Names
BTLA; BTLA1; CD272
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BTLA; Polyclonal Antibody; BTLA antibody - C-terminal region; anti-BTLA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLV
Sequence Length
289
Applicable Applications for anti-BTLA antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BTLA AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-BTLA AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-BTLA antibody
This is a rabbit polyclonal antibody against BTLA. It was validated on Western Blot

Target Description: This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis.
Product Categories/Family for anti-BTLA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
B- and T-lymphocyte attenuator isoform 1
NCBI Official Synonym Full Names
B and T lymphocyte associated
NCBI Official Symbol
BTLA
NCBI Official Synonym Symbols
BTLA1; CD272
NCBI Protein Information
B- and T-lymphocyte attenuator
UniProt Protein Name
B- and T-lymphocyte attenuator
UniProt Gene Name
BTLA
UniProt Entry Name
BTLA_HUMAN

NCBI Description

This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011]

Uniprot Description

BTLA: Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q13.2

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: receptor activity

Biological Process: T cell costimulation; negative regulation of alpha-beta T cell proliferation; immune response-regulating cell surface receptor signaling pathway; negative regulation of B cell proliferation

Research Articles on BTLA

Similar Products

Product Notes

The BTLA btla (Catalog #AAA3215480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BTLA antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's BTLA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BTLA btla for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRPWLLYSLL PLGGLPLLIT TCFCLFCCLR RHQGKQNELS DTAGREINLV. It is sometimes possible for the material contained within the vial of "BTLA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.