Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BTF3 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateBTF3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit BTF3 Polyclonal Antibody | anti-BTF3 antibody

BTF3 antibody - middle region

Gene Names
BTF3; NACB; BTF3a; BTF3b; BETA-NAC
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
BTF3; Polyclonal Antibody; BTF3 antibody - middle region; anti-BTF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Sequence Length
206
Applicable Applications for anti-BTF3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BTF3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BTF3 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateBTF3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-BTF3 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateBTF3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-BTF3 antibody
This is a rabbit polyclonal antibody against BTF3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BTF3 forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Product Categories/Family for anti-BTF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
689
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
transcription factor BTF3 isoform A
NCBI Official Synonym Full Names
basic transcription factor 3
NCBI Official Symbol
BTF3
NCBI Official Synonym Symbols
NACB; BTF3a; BTF3b; BETA-NAC
NCBI Protein Information
transcription factor BTF3
UniProt Protein Name
Transcription factor BTF3
UniProt Gene Name
BTF3
UniProt Synonym Gene Names
NACB; NAC-beta
UniProt Entry Name
BTF3_HUMAN

NCBI Description

This gene encodes the basic transcription factor 3. This protein forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]

Uniprot Description

BTF3: a general transcription factor. BTF3 can form a stable complex with RNA polymerase II. An interaction partner of protein kinase CK2. Required for the initiation of transcription. Expressed at high levels in glioblastoma multiforme. Overexpressed in the microsatellite instability (MIN) phenotypes in colorectal cancer. Up-regulated strongly in the mammary gland during pregnancy, suggesting an involvement in alveolar growth. Two alternatively spliced isoforms have been described.

Protein type: Transcription factor; Transcription initiation complex

Chromosomal Location of Human Ortholog: 5q13.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; protein transport; regulation of transcription, DNA-dependent; in utero embryonic development

Research Articles on BTF3

Similar Products

Product Notes

The BTF3 btf3 (Catalog #AAA3203856) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BTF3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BTF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BTF3 btf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSLTSLRRLA EALPKQSVDG KAPLATGEDD DDEVPDLVEN FDEASKNEAN. It is sometimes possible for the material contained within the vial of "BTF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.