Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BST2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit anti-Human BST2 Polyclonal Antibody | anti-BST2 antibody

BST2 antibody - N-terminal region

Gene Names
BST2; CD317; TETHERIN
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BST2; Polyclonal Antibody; BST2 antibody - N-terminal region; anti-BST2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRA
Sequence Length
180
Applicable Applications for anti-BST2 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BST2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-BST2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-BST2 antibody
This is a rabbit polyclonal antibody against BST2. It was validated on Western Blot

Target Description: Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
Product Categories/Family for anti-BST2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
684
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
bone marrow stromal antigen 2
NCBI Official Synonym Full Names
bone marrow stromal cell antigen 2
NCBI Official Symbol
BST2
NCBI Official Synonym Symbols
CD317; TETHERIN
NCBI Protein Information
bone marrow stromal antigen 2
UniProt Protein Name
Bone marrow stromal antigen 2
UniProt Gene Name
BST2
UniProt Synonym Gene Names
BST-2
UniProt Entry Name
BST2_HUMAN

NCBI Description

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008]

Uniprot Description

BST2: IFN-induced antiviral host restriction factor which efficiently blocks the release of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Acts as a direct physical tether, holding virions to the cell membrane and linking virions to each other. The tethered virions can be internalized by endocytosis and subsequently degraded or they can remain on the cell surface. In either case, their spread as cell-free virions is restricted. Its target viruses belong to diverse families, including retroviridae: human immunodeficiency virus type 1 (HIV-1), human immunodeficiency virus type 2 (HIV-2), simian immunodeficiency viruses (SIVs), equine infectious anemia virus (EIAV), feline immunodeficiency virus (FIV), prototype foamy virus (PFV), Mason- Pfizer monkey virus (MPMV), human T-cell leukemia virus type 1 (HTLV-1), Rous sarcoma virus (RSV) and murine leukemia virus (MLV), flavivirideae: hepatitis C virus (HCV), filoviridae: ebola virus (EBOV) and marburg virus (MARV), arenaviridae: lassa virus (LASV) and machupo virus (MACV), herpesviridae: kaposis sarcoma- associated herpesvirus (KSHV), rhabdoviridae: vesicular stomatitis virus (VSV), orthomyxoviridae: influenza A virus, and paramyxoviridae: nipah virus. Can inhibit cell surface proteolytic activity of MMP14 causing decreased activation of MMP15 which results in inhibition of cell growth and migration. Can stimulate signaling by LILRA4/ILT7 and consequently provide negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection. Plays a role in the organization of the subapical actin cytoskeleton in polarized epithelial cells. Belongs to the tetherin family.

Protein type: Membrane protein, GPI anchor; Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: Golgi apparatus; cell surface; membrane; integral to plasma membrane; cytoplasm; apical plasma membrane; late endosome; plasma membrane; lipid raft

Molecular Function: metalloendopeptidase inhibitor activity; signal transducer activity; protein binding; protein homodimerization activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; B cell activation; response to virus; cytokine and chemokine mediated signaling pathway; multicellular organismal development; humoral immune response; cell proliferation; negative regulation of plasmacytoid dendritic cell cytokine production; cell-cell signaling; negative regulation of viral genome replication; regulation of actin cytoskeleton organization and biogenesis; innate immune response; negative regulation of cell growth; defense response to virus; negative regulation of cell migration

Research Articles on BST2

Similar Products

Product Notes

The BST2 bst2 (Catalog #AAA3215239) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BST2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BST2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BST2 bst2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVPMEDGDKR CKLLLGIGIL VLLIIVILGV PLIIFTIKAN SEACRDGLRA. It is sometimes possible for the material contained within the vial of "BST2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.