Western Blot (WB)
(Host: RabbitTarget Name: BNC1Sample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human BNC1 Polyclonal Antibody | anti-BNC1 antibody
BNC1 Antibody - middle region
Gene Names
BNC1; BNC; BSN1; HsT19447
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BNC1; Polyclonal Antibody; BNC1 Antibody - middle region; anti-BNC1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASSENYKCPGFTVTSPDCRPPPSYPGSGEDSKGQPAFPNIGQNGVLFPNL
Sequence Length
994
Applicable Applications for anti-BNC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human BNC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: BNC1Sample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BNC1Sample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BNC1 antibody
This is a rabbit polyclonal antibody against BNC1. It was validated on Western Blot
Target Description: The protein encoded by this gene is a zinc finger protein present in the basal cell layer of the epidermis and in hair follicles. It is also found in abundance in the germ cells of testis and ovary. This protein is thought to play a regulatory role in keratinocyte proliferation and it may also be a regulator for rRNA transcription. Alternative splicing of this gene results in multiple transcript variants, and multiple polyadenylation sites are indicated.
Target Description: The protein encoded by this gene is a zinc finger protein present in the basal cell layer of the epidermis and in hair follicles. It is also found in abundance in the germ cells of testis and ovary. This protein is thought to play a regulatory role in keratinocyte proliferation and it may also be a regulator for rRNA transcription. Alternative splicing of this gene results in multiple transcript variants, and multiple polyadenylation sites are indicated.
Product Categories/Family for anti-BNC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
zinc finger protein basonuclin-1 isoform a
NCBI Official Synonym Full Names
basonuclin 1
NCBI Official Symbol
BNC1
NCBI Official Synonym Symbols
BNC; BSN1; HsT19447
NCBI Protein Information
zinc finger protein basonuclin-1
UniProt Protein Name
Zinc finger protein basonuclin-1
Protein Family
UniProt Gene Name
BNC1
UniProt Synonym Gene Names
BNC
UniProt Entry Name
BNC1_HUMAN
NCBI Description
The protein encoded by this gene is a zinc finger protein present in the basal cell layer of the epidermis and in hair follicles. It is also found in abundance in the germ cells of testis and ovary. This protein is thought to play a regulatory role in keratinocyte proliferation and it may also be a regulator for rRNA transcription. Alternative splicing of this gene results in multiple transcript variants, and multiple polyadenylation sites are indicated.[provided by RefSeq, Jul 2014]
Research Articles on BNC1
Similar Products
Product Notes
The BNC1 bnc1 (Catalog #AAA3220183) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BNC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BNC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BNC1 bnc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASSENYKCPG FTVTSPDCRP PPSYPGSGED SKGQPAFPNI GQNGVLFPNL. It is sometimes possible for the material contained within the vial of "BNC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
