Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BMPR1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human BMPR1A Polyclonal Antibody | anti-BMPR1A antibody

BMPR1A Antibody - N-terminal region

Gene Names
BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BMPR1A; Polyclonal Antibody; BMPR1A Antibody - N-terminal region; anti-BMPR1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCF
Sequence Length
532
Applicable Applications for anti-BMPR1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BMPR1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BMPR1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BMPR1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-BMPR1A antibody
This is a rabbit polyclonal antibody against BMPR1A. It was validated on Western Blot

Target Description: The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
657
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Synonym Full Names
bone morphogenetic protein receptor type 1A
NCBI Official Symbol
BMPR1A
NCBI Official Synonym Symbols
ALK3; SKR5; CD292; ACVRLK3; 10q23del
NCBI Protein Information
bone morphogenetic protein receptor type-1A
UniProt Protein Name
Bone morphogenetic protein receptor type-1A
UniProt Gene Name
BMPR1A
UniProt Synonym Gene Names
ACVRLK3; ALK3; BMP type-1A receptor; BMPR-1A; ALK-3; SKR5
UniProt Entry Name
BMR1A_HUMAN

NCBI Description

The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. [provided by RefSeq, Jul 2008]

Uniprot Description

BMPR1A: a serine/threonine-protein kinase receptor for Bone morphogenetic protein-2 and -4 (BMP-2 and BMP-4). Defects in BMPR1A are a cause of juvenile polyposis syndrome (JPS) and Cowden disease (CD), a cancer syndrome characterized by multiple hamartomas and by a high risk for breast, thyroid and endometriel cancers.

Protein type: Kinase, protein; EC 2.7.11.30; Protein kinase, Ser/Thr (receptor); Protein kinase, TKL; Membrane protein, integral; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: cell soma; dendrite; plasma membrane; integral to membrane; caveola

Molecular Function: transforming growth factor beta receptor activity; protein serine/threonine kinase activity; protein binding; protein homodimerization activity; metal ion binding; SMAD binding; transmembrane receptor protein serine/threonine kinase activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: neural plate mediolateral pattern formation; transcription from RNA polymerase II promoter; developmental growth; hindlimb morphogenesis; neural crest cell development; positive regulation of transcription, DNA-dependent; mesendoderm development; paraxial mesoderm structural organization; dorsal/ventral axis specification; palate development; protein amino acid phosphorylation; negative regulation of neurogenesis; BMP signaling pathway; transforming growth factor beta receptor signaling pathway; positive regulation of mesenchymal cell proliferation; ectoderm development; Mullerian duct regression; somitogenesis; in utero embryonic development; lateral mesoderm development; stem cell maintenance; positive regulation of bone mineralization; odontogenesis of dentine-containing teeth; positive regulation of osteoblast differentiation; mesoderm formation; pituitary gland development; cartilage development; embryonic organ development; immune response; embryonic digit morphogenesis; regulation of lateral mesodermal cell fate specification; positive regulation of epithelial cell proliferation; lung development

Disease: Juvenile Polyposis Syndrome; Polyposis Syndrome, Hereditary Mixed, 2

Research Articles on BMPR1A

Similar Products

Product Notes

The BMPR1A bmpr1a (Catalog #AAA3219414) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMPR1A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BMPR1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMPR1A bmpr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMKSDSDQKK SENGVTLAPE DTLPFLKCYC SGHCPDDAIN NTCITNGHCF. It is sometimes possible for the material contained within the vial of "BMPR1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.