Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BMP8ASample Tissue: Human large intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BMP8A Polyclonal Antibody | anti-BMP8A antibody

BMP8A Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BMP8A; Polyclonal Antibody; BMP8A Antibody - middle region; anti-BMP8A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV
Sequence Length
402
Applicable Applications for anti-BMP8A antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BMP8A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BMP8ASample Tissue: Human large intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BMP8ASample Tissue: Human large intestine Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BMP8A antibody
bone morphogenetic protein 8a

Target Description: This gene encodes a member of the transforming growth factor beta superfamily of regulatory proteins. The encoded preproprotein undergoes proteolytic processing to generate the mature protein. Studies in laboratory mice suggest that this protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44 kDa
NCBI Official Full Name
bone morphogenetic protein 8A preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 8a
NCBI Official Symbol
BMP8A
NCBI Protein Information
bone morphogenetic protein 8A
UniProt Protein Name
Bone morphogenetic protein 8A
UniProt Gene Name
BMP8A
UniProt Synonym Gene Names
BMP-8A
UniProt Entry Name
BMP8A_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein may play a role in development of the reproductive system. This gene may have arose from a gene duplication event and its gene duplicate is also present on chromosome 1. [provided by RefSeq, Jul 2016]

Uniprot Description

BMP8A: Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: regulation of apoptosis; BMP signaling pathway; ossification; diet induced thermogenesis; cartilage development; regulation of MAPKKK cascade; cell development; negative regulation of insulin secretion; growth

Research Articles on BMP8A

Similar Products

Product Notes

The BMP8A bmp8a (Catalog #AAA3216773) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP8A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BMP8A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMP8A bmp8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FFRASPSPIR TPRAVRPLRR RQPKKSNELP QANRLPGIFD DVRGSHGRQV. It is sometimes possible for the material contained within the vial of "BMP8A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.