Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BMP6Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit BMP6 Polyclonal Antibody | anti-BMP6 antibody

BMP6 antibody - N-terminal region

Gene Names
BMP6; VGR; VGR1
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BMP6; Polyclonal Antibody; BMP6 antibody - N-terminal region; anti-BMP6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP
Sequence Length
513
Applicable Applications for anti-BMP6 antibody
Western Blot (WB)
Homology
Cow: 77%; Human: 100%; Mouse: 83%; Pig: 85%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BMP6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BMP6Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BMP6Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-BMP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateBMP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-BMP6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateBMP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-BMP6 antibody
This is a rabbit polyclonal antibody against BMP6. It was validated on Western Blot

Target Description: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
654
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
bone morphogenetic protein 6 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 6
NCBI Official Symbol
BMP6
NCBI Official Synonym Symbols
VGR; VGR1
NCBI Protein Information
bone morphogenetic protein 6
UniProt Protein Name
Bone morphogenetic protein 6
UniProt Gene Name
BMP6
UniProt Synonym Gene Names
VGR; BMP-6; VG-1-R; VGR-1
UniProt Entry Name
BMP6_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients. [provided by RefSeq, Jul 2016]

Uniprot Description

BMP6: Induces cartilage and bone formation. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6p24-p23

Cellular Component: extracellular space; cytoplasm

Molecular Function: growth factor activity; protein heterodimerization activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: cellular iron ion homeostasis; response to glucocorticoid stimulus; BMP signaling pathway; regulation of apoptosis; response to magnesium ion; positive regulation of endothelial cell differentiation; positive regulation of aldosterone biosynthetic process; male genitalia development; inflammatory response; kidney development; response to iron ion; skeletal development; endochondral ossification; response to retinoic acid; positive regulation of bone mineralization; osteoblast differentiation; positive regulation of osteoblast differentiation; positive regulation of chondrocyte differentiation; positive regulation of protein secretion; eye development; regulation of MAPKKK cascade; cartilage development; immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; response to activity; positive regulation of neuron differentiation; positive regulation of epithelial cell proliferation; growth

Research Articles on BMP6

Similar Products

Product Notes

The BMP6 bmp6 (Catalog #AAA3214038) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP6 antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BMP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMP6 bmp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGGSPGRTEQ PPPSPQSSSG FLYRRLKTQE KREMQKEILS VLGLPHRPRP. It is sometimes possible for the material contained within the vial of "BMP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.