Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BMP3 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)

Rabbit anti-Human BMP3 Polyclonal Antibody | anti-BMP3 antibody

BMP3 Antibody - C-terminal region

Gene Names
BMP3; BMP-3A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BMP3; Polyclonal Antibody; BMP3 Antibody - C-terminal region; anti-BMP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEVWEERKPYKTLQAQAPEKSKNKKKQRKGPHRKSQTLQFDEQTLKKARR
Sequence Length
472
Applicable Applications for anti-BMP3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human BMP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BMP3 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-BMP3 antibody Titration: 1 ug/mLSample Type: Human MCF7 Whole Cell)
Related Product Information for anti-BMP3 antibody
This is a rabbit polyclonal antibody against BMP3. It was validated on Western Blot

Target Description: BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation.
Product Categories/Family for anti-BMP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
651
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51 kDa
NCBI Official Full Name
bone morphogenetic protein 3 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 3
NCBI Official Symbol
BMP3
NCBI Official Synonym Symbols
BMP-3A
NCBI Protein Information
bone morphogenetic protein 3
UniProt Protein Name
Bone morphogenetic protein 3
UniProt Gene Name
BMP3
UniProt Synonym Gene Names
BMP3A; BMP-3; BMP-3A
UniProt Entry Name
BMP3_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein suppresses osteoblast differentiation, and negatively regulates bone density, by modulating TGF-beta receptor availability to other ligands. [provided by RefSeq, Jul 2016]

Uniprot Description

BMP3: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding; receptor binding

Biological Process: regulation of apoptosis; ossification; cell-cell signaling; regulation of MAPKKK cascade; cartilage development; positive regulation of transcription from RNA polymerase II promoter; skeletal development; cell development; growth

Research Articles on BMP3

Similar Products

Product Notes

The BMP3 bmp3 (Catalog #AAA3219674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BMP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMP3 bmp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEVWEERKPY KTLQAQAPEK SKNKKKQRKG PHRKSQTLQF DEQTLKKARR. It is sometimes possible for the material contained within the vial of "BMP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.