Western Blot (WB)
(Anti- BMP-2 Picoband antibody, MBS177931, Western blottingAll lanes: Anti BMP-2 (MBS177931) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 20 KD, 40KD )
anti-Human, Rat BMP2 Polyclonal Antibody | anti-BMP2 antibody
Anti-BMP2 Antibody
Gene Names
BMP2; BDA2; BMP2A
Reactivity
Human, Rat
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Immunogen Affinity Purified
Synonyms
BMP2; Polyclonal Antibody; Anti-BMP2 Antibody; Bone morphogenetic protein 2; BDA2; BMP-2; BMP-2A; Bmp2; BMP2_HUMAN; BMP2A; Bone morphogenetic protein 2A; bone morphogenetic protein 2; anti-BMP2 antibody
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
396
Applicable Applications for anti-BMP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA)
Application Notes
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- BMP-2 Picoband antibody, MBS177931, Western blottingAll lanes: Anti BMP-2 (MBS177931) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 20 KD, 40KD )
Western Blot (WB)
(Anti- BMP-2 Picoband antibody, MBS177931, Western blottingAll lanes: Anti BMP-2 (MBS177931) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 20 KD, 40KD )
Immunohistochemistry (IHC)
(Anti- BMP-2 Picoband antibody, MBS177931, IHC(P)IHC(P): Human Intestinal Cancer Tissue )
Immunohistochemistry (IHC)
(Anti- BMP-2 Picoband antibody, MBS177931, IHC(P)IHC(P): Human Intestinal Cancer Tissue )
Related Product Information for anti-BMP2 antibody
Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human;Rat.
Background: BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. BMP-2, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation and epithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.
Background: BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. BMP-2, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation and epithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.
References
1. Gopal Rao, V. V. N., Loffler, C., Wozney, J. M., Hansmann, I. The gene for bone morphogenetic protein 2A (BMP2A) is localized to human chromosome 20p12 by radioactive and nonradioactive in situ hybridization. Hum. Genet. 90: 299-302, 1992. 2. Kaplan, F. S., Tabas, J. A., Zasloff, M. A. Fibrodysplasia ossificans progressiva: a clue from the fly? Calcif. Tissue Int. 47: 117-125, 1990. 3. Sampath TK, Coughlin JE, Whetstone RM, Banach D, Corbett C, Ridge RJ, Ozkaynak E, Oppermann H, Rueger DC (August 1990)."Bovine osteogenic protein is composed of dimers of OP-1 and BMP-2A, two members of the transforming growth factor-beta superfamily". J. Biol. Chem. 265 (22): 13198-205.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,702 Da
NCBI Official Full Name
bone morphogenetic protein 2 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 2
NCBI Official Symbol
BMP2
NCBI Official Synonym Symbols
BDA2; BMP2A
NCBI Protein Information
bone morphogenetic protein 2
UniProt Protein Name
Bone morphogenetic protein 2
Protein Family
UniProt Gene Name
BMP2
UniProt Synonym Gene Names
BMP2A; BMP-2; BMP-2A
UniProt Entry Name
BMP2_HUMAN
NCBI Description
This gene encodes a member of the transforming growth factor-beta (TGFB) superfamily. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which induces bone and cartilage formation. [provided by RefSeq, Nov 2015]
Uniprot Description
Induces cartilage and bone formation (PubMed:3201241). Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4 (PubMed:24362451).
Research Articles on BMP2
Similar Products
Product Notes
The BMP2 bmp2 (Catalog #AAA177931) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-BMP2 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BMP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA). ELISA Concentration: 0.1-0.5ug/ml Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the BMP2 bmp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
