Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BMP1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

Rabbit BMP1 Polyclonal Antibody | anti-BMP1 antibody

BMP1 Antibody - middle region

Gene Names
BMP1; PCP; TLD; OI13; PCP2; PCOLC
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BMP1; Polyclonal Antibody; BMP1 Antibody - middle region; anti-BMP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSE
Sequence Length
622
Applicable Applications for anti-BMP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human BMP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BMP1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BMP1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-BMP1 antibody
This is a rabbit polyclonal antibody against BMP1. It was validated on Western Blot

Target Description: This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region.
Product Categories/Family for anti-BMP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
649
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
bone morphogenetic protein 1 isoform 3
NCBI Official Synonym Full Names
bone morphogenetic protein 1
NCBI Official Symbol
BMP1
NCBI Official Synonym Symbols
PCP; TLD; OI13; PCP2; PCOLC
NCBI Protein Information
bone morphogenetic protein 1
UniProt Protein Name
Bone morphogenetic protein 1
UniProt Gene Name
BMP1
UniProt Synonym Gene Names
PCOLC; BMP-1; mTld; PCP
UniProt Entry Name
BMP1_HUMAN

NCBI Description

This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region. [provided by RefSeq, Aug 2008]

Uniprot Description

BMP1: Cleaves the C-terminal propeptides of procollagen I, II and III. Induces cartilage and bone formation. May participate in dorsoventral patterning during early development by cleaving chordin (CHRD). Defects in BMP1 are a cause of autosomal recessive osteogenesis imperfecta (AR-OI). A connective tissue disorder characterized by bone fragility, progressively deforming bones, bowing of limbs due to multiple fractures, very short stature, a triangular face, severe scoliosis, and grayish sclera. AR-OI due to BMP1 mutations belongs to the group of osteogenesis imperfecta type III in the Sillence classification. Belongs to the peptidase M12A family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.24.19; Cytokine; Protease

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: Golgi apparatus; proteinaceous extracellular matrix; extracellular space; extracellular region

Molecular Function: peptidase activity; growth factor activity; metallopeptidase activity; zinc ion binding; metalloendopeptidase activity; cytokine activity; calcium ion binding

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; ossification; multicellular organismal development; lipoprotein metabolic process; cell differentiation; proteolysis; skeletal development; cartilage condensation

Disease: Osteogenesis Imperfecta, Type Xiii

Research Articles on BMP1

Similar Products

Product Notes

The BMP1 bmp1 (Catalog #AAA3216044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMP1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BMP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMP1 bmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNWVGKGFFA VYEAICGGDV KKDYGHIQSP NYPDDYRPSK VCIWRIQVSE. It is sometimes possible for the material contained within the vial of "BMP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.