Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of U-937 cells, using BMI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)

Rabbit anti-Human, Mouse BMI1 Polyclonal Antibody | anti-BMI1 antibody

BMI1 Polyclonal Antibody

Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
BMI1; Polyclonal Antibody; BMI1 Polyclonal Antibody; flvi-2/bmi-1; FLVI2/BMI1; PCGF4; RNF51; anti-BMI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Sequence Length
469
Applicable Applications for anti-BMI1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human BMI1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of U-937 cells, using BMI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of U-937 cells, using BMI1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.)

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using BMI1 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using BMI1 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-BMI1 antibody
This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.
Product Categories/Family for anti-BMI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 36kDa
Observed: 37kDa
NCBI Official Full Name
COMMD3-BMI1 read-through protein
NCBI Official Synonym Full Names
COMMD3-BMI1 readthrough
NCBI Official Symbol
COMMD3-BMI1
NCBI Protein Information
COMMD3-BMI1 read-through protein
UniProt Protein Name
Polycomb complex protein BMI-1
Protein Family
UniProt Gene Name
BMI1
UniProt Synonym Gene Names
PCGF4; RNF51

NCBI Description

This locus represents naturally occurring read-through transcription between the neighboring COMM domain-containing protein 3 and polycomb complex protein BMI-1 genes on chromosome 10. The read-through transcript produces a fusion protein that shares sequence identity with each individual gene product. [provided by RefSeq, Feb 2011]

Uniprot Description

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:15386022, PubMed:16359901, PubMed:26151332, PubMed:16714294, PubMed:21772249, PubMed:25355358, PubMed:27827373). The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A (PubMed:21772249, PubMed:25355358). In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2 (PubMed:15386022, PubMed:26151332, PubMed:21772249).

Similar Products

Product Notes

The BMI1 bmi1 (Catalog #AAA9133512) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BMI1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's BMI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500 - 1:2000 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the BMI1 bmi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EDKRIITDDE IISLSIEFFD QNRLDRKVNK DKEKSKEEVN DKRYLRCPAA MTVMHLRKFL RSKMDIPNTF QIDVMYEEEP LKDYYTLMDI AYIYTWRRNG PLPLKYRVRP TCKRMKISHQ RDGLTNAGEL ESDSGSDKAN SPAGGIPSTS SCLPSPSTPV QSPHPQFPHI SSTMNGTSNS PSGNHQSSFA NRPRKSSVNG SSATSSG. It is sometimes possible for the material contained within the vial of "BMI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.