Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BLVRA expression in transfected 293T cell line by BLVRA polyclonal antibody. Lane 1: BLVRA transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human BLVRA Polyclonal Antibody | anti-BLVRA antibody

BLVRA (Biliverdin Reductase A, BVR A, Biliverdin-IX alpha-reductase, BLVR, BVR)

Gene Names
BLVRA; BVR; BLVR; BVRA
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BLVRA; Polyclonal Antibody; BLVRA (Biliverdin Reductase A; BVR A; Biliverdin-IX alpha-reductase; BLVR; BVR); Anti -BLVRA (Biliverdin Reductase A; anti-BLVRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BLVRA.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Applicable Applications for anti-BLVRA antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human BLVRA, aa1-296 (NP_000703.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BLVRA expression in transfected 293T cell line by BLVRA polyclonal antibody. Lane 1: BLVRA transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BLVRA expression in transfected 293T cell line by BLVRA polyclonal antibody. Lane 1: BLVRA transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BLVRA antibody
BLVRA, also known as biliverdin reductase A, belongs to the gfo/idh/mocA family. This protein is an enzyme that converts biliverdin to bilirubin, converting a double-bond between the second and third pyrrole ring into a single-bond.(Bilirubin + NAD(P)+ = biliverdin + NAD(P)H) Recombinant BLVRA protein, expressed in E. coli and purified by using conventional chromatography techniques.
Product Categories/Family for anti-BLVRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
644
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,428 Da
NCBI Official Full Name
biliverdin reductase A
NCBI Official Synonym Full Names
biliverdin reductase A
NCBI Official Symbol
BLVRA
NCBI Official Synonym Symbols
BVR; BLVR; BVRA
NCBI Protein Information
biliverdin reductase A; BVR A; biliverdin-IX alpha-reductase
UniProt Protein Name
Biliverdin reductase A
Protein Family
UniProt Gene Name
BLVRA
UniProt Synonym Gene Names
BLVR; BVR; BVR A
UniProt Entry Name
BIEA_HUMAN

NCBI Description

The protein encoded by this gene belongs to the biliverdin reductase family, members of which catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH. Mutations in this gene are associated with hyperbiliverdinemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

Function: Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.

Catalytic activity: Bilirubin + NAD(P)+ = biliverdin + NAD(P)H.

Cofactor: Binds 1 zinc ion per subunit.

Pathway: Porphyrin-containing compound metabolism; protoheme degradation.

Subunit structure: Monomer.

Subcellular location: Cytoplasm.

Tissue specificity: Liver.

Involvement in disease: Hyperbiliverdinemia (HBLVD) [MIM:614156]: A condition characterized by a green discoloration of the skin, urine, serum, and other bodily fluids. It is due to increased biliverdin resulting from inefficient conversion to bilirubin. Affected individuals appear to have symptoms only in the context of obstructive cholestasis and/or liver failure. In some cases, green jaundice can resolve after resolution of obstructive cholestasis.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.11

Miscellaneous: Uses the reactants NADH or NADPH depending on the pH; NADH is used at the acidic pH range (6-6.9) and NADPH at the alkaline range (8.5-8.7). NADPH, however, is the probable reactant in biological systems.

Sequence similarities: Belongs to the Gfo/Idh/MocA family. Biliverdin reductase subfamily.

Research Articles on BLVRA

Similar Products

Product Notes

The BLVRA blvra (Catalog #AAA647102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BLVRA (Biliverdin Reductase A, BVR A, Biliverdin-IX alpha-reductase, BLVR, BVR) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BLVRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the BLVRA blvra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNAEPERKFG VVVVGVGRAG SVRMRDLRNP HPSSAFLNLI GFVSRRELGS IDGVQQISLE DALSSQEVEV AYICSESSSH EDYIRQFLNA GKHVLVEYPM TLSLAAAQEL WELAEQKGKV LHEEHVELLM EEFAFLKKEV VGKDLLKGSL LFTAGPLEEE RFGFPAFSGI SRLTWLVSLF GELSLVSATL EERKEDQYMK MTVCLETEKK SPLSWIEEKG PGLKRNRYLS FHFKSGSLEN VPNVGVNKNI FLKDQNIFVQ KLLGQFSEKE LAAEKKRILH CLGLAEEIQK YCCSRK. It is sometimes possible for the material contained within the vial of "BLVRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.