Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BHMT2Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BHMT2 Polyclonal Antibody | anti-BHMT2 antibody

BHMT2 Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BHMT2; Polyclonal Antibody; BHMT2 Antibody - C-terminal region; anti-BHMT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWI
Sequence Length
406
Applicable Applications for anti-BHMT2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human BHMT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BHMT2Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BHMT2Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BHMT2 antibody
Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA, proteins, lipids, and other intracellular metabolites. The protein encoded by this gene is one of two methyl transferases that can catalyze the transfer of the methyl group from betaine to homocysteine. Anomalies in homocysteine metabolism have been implicated in disorders ranging from vascular disease to neural tube birth defects such as spina bifida. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-BHMT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44 kDa
NCBI Official Full Name
S-methylmethionine--homocysteine S-methyltransferase BHMT2 isoform 2
NCBI Official Synonym Full Names
betaine--homocysteine S-methyltransferase 2
NCBI Official Symbol
BHMT2
NCBI Protein Information
S-methylmethionine--homocysteine S-methyltransferase BHMT2
UniProt Protein Name
Betaine--homocysteine S-methyltransferase 1
UniProt Gene Name
BHMT
UniProt Entry Name
BHMT1_HUMAN

NCBI Description

Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA, proteins, lipids, and other intracellular metabolites. The protein encoded by this gene is one of two methyl transferases that can catalyze the transfer of the methyl group from betaine to homocysteine. Anomalies in homocysteine metabolism have been implicated in disorders ranging from vascular disease to neural tube birth defects such as spina bifida. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010]

Uniprot Description

BHMT: Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Amino Acid Metabolism - cysteine and methionine; EC 2.1.1.5; Methyltransferase

Chromosomal Location of Human Ortholog: 5q14.1

Cellular Component: protein complex; cytoplasm; cytosol

Molecular Function: betaine-homocysteine S-methyltransferase activity; homocysteine S-methyltransferase activity; zinc ion binding; protein complex binding

Biological Process: S-methylmethionine cycle; protein amino acid methylation; betaine catabolic process; sulfur amino acid metabolic process; S-adenosylmethionine metabolic process; response to organic nitrogen; regulation of homocysteine metabolic process; betaine metabolic process

Research Articles on BHMT2

Similar Products

Product Notes

The BHMT2 bhmt (Catalog #AAA3222609) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BHMT2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BHMT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BHMT2 bhmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RYIGGCCGFE PYHIRAIAEE LAPERGFLPP ASEKHGSWGS GLDMHTKPWI. It is sometimes possible for the material contained within the vial of "BHMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.