Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BTC expression in transfected 293T cell line by BTC polyclonal antibody. Lane 1: BTC transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Betacellulin Polyclonal Antibody | anti-BTC antibody

Betacellulin (BTC, Probetacellulin) (PE)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Betacellulin; Polyclonal Antibody; Betacellulin (BTC; Probetacellulin) (PE); anti-BTC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BTC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-BTC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BTC, aa1-178 (NP_001720.1).
Immunogen Sequence
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BTC expression in transfected 293T cell line by BTC polyclonal antibody. Lane 1: BTC transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BTC expression in transfected 293T cell line by BTC polyclonal antibody. Lane 1: BTC transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between BTC and ERBB2. HeLa cells were stained with BTC rabbit purified polyclonal 1:1200 and ERBB2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between BTC and ERBB2. HeLa cells were stained with BTC rabbit purified polyclonal 1:1200 and ERBB2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-BTC antibody
Betacellulin (BTC) is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. It is a ligand for the EGF receptor.
Product Categories/Family for anti-BTC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
685
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,746 Da
NCBI Official Full Name
probetacellulin
NCBI Official Synonym Full Names
betacellulin
NCBI Official Symbol
BTC
NCBI Protein Information
probetacellulin
UniProt Protein Name
Probetacellulin
Protein Family
UniProt Gene Name
BTC
UniProt Synonym Gene Names
BTC
UniProt Entry Name
BTC_HUMAN

NCBI Description

The protein encoded by this gene is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

BTC: Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Protein type: Membrane protein, integral; Cell cycle regulation; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular space; extracellular region; integral to membrane; plasma membrane

Molecular Function: protein binding; growth factor activity; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of fibroblast proliferation; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; positive regulation of mitosis; positive regulation of cell proliferation; innate immune response; positive regulation of cell differentiation; negative regulation of apoptosis

Research Articles on BTC

Similar Products

Product Notes

The BTC btc (Catalog #AAA6371507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Betacellulin (BTC, Probetacellulin) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Betacellulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BTC btc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Betacellulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.