Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Beta III Tubulin expression in rat brian extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Beta III Tubulin at 55KD was detected using rabbit anti- Beta III Tubulin Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit Beta III Tubulin Polyclonal Antibody | anti-TUBB3 antibody

Anti-Beta III Tubulin Antibody

Gene Names
TUBB3; CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
Beta III Tubulin; Polyclonal Antibody; Anti-Beta III Tubulin Antibody; beta 3 tubulin; beta-4; CDCBM; CDCBM1; CFEOM3A; CFEOM3; FEOM3; M(beta)3; M(beta)6; MC1R; Tubb 3; TUBB3; TUBB4; Tubulin beta 3; Tubulin beta 3 chain; Tubulin beta 4; Tubulin beta-4 chain; Tubulin beta III; Tubulin beta-III; Q13509; tubulin beta 3 class III; anti-TUBB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
378
Applicable Applications for anti-TUBB3 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Beta III Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Beta III Tubulin expression in rat brian extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Beta III Tubulin at 55KD was detected using rabbit anti- Beta III Tubulin Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Beta III Tubulin expression in rat brian extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Beta III Tubulin at 55KD was detected using rabbit anti- Beta III Tubulin Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(Beta III Tubulin was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- Beta III Tubulin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Beta III Tubulin was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- Beta III Tubulin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Beta III Tubulin was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- Beta III Tubulin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Beta III Tubulin was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- Beta III Tubulin Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-TUBB3 antibody
Rabbit IgG polyclonal antibody for Tubulin beta-3 chain(TUBB3) detection.
Background: Tubulin beta-3 chain is a protein that in humans is encoded by the TUBB3 gene. This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.
References
1. Ranganathan S, Dexter DW, Benetatos CA, Hudes GR (Mar 1998). "Cloning and sequencing of human betaIII-tubulin cDNA: induction of betaIII isotype in human prostate carcinoma cells by acute exposure to antimicrotubule agents". Biochim Biophys Acta. 1395 (2): 237-45.
2. Cicchillitti L, Penci R, Di Michele M, Filippetti F, Rotilio D, Donati MB, Scambia G, Ferlini C (July 2008).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,433 Da
NCBI Official Full Name
tubulin beta-3 chain isoform 2
NCBI Official Synonym Full Names
tubulin beta 3 class III
NCBI Official Symbol
TUBB3
NCBI Official Synonym Symbols
CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A
NCBI Protein Information
tubulin beta-3 chain
UniProt Protein Name
Tubulin beta-3 chain
Protein Family
UniProt Gene Name
TUBB3
UniProt Synonym Gene Names
TUBB4

NCBI Description

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Oct 2010]

Uniprot Description

TUBB3: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. TUBB3 plays a critical role in proper axon guidance and mantainance. Dimer of alpha and beta chains. Expression is primarily restricted to central and peripheral nervous system. Greatly increased expression in most cancerous tissues. Belongs to the tubulin family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 16q24.3

Cellular Component: dendrite; microtubule; nucleus

Molecular Function: protein binding

Biological Process: axon guidance

Disease: Cortical Dysplasia, Complex, With Other Brain Malformations 1; Fibrosis Of Extraocular Muscles, Congenital, 3a, With Or Without Extraocular Involvement

Research Articles on TUBB3

Similar Products

Product Notes

The TUBB3 tubb3 (Catalog #AAA178655) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Beta III Tubulin Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Beta III Tubulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the TUBB3 tubb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Beta III Tubulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.