Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF polyclonal antibody. Lane 1: BDNF transfected lysate (28.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human BDNF Polyclonal Antibody | anti-BDNF antibody

BDNF (Brain-derived Neurotrophic Factor, Abrineurin) (FITC)

Gene Names
BDNF; ANON2; BULN2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BDNF; Polyclonal Antibody; BDNF (Brain-derived Neurotrophic Factor; Abrineurin) (FITC); anti-BDNF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BDNF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
255
Applicable Applications for anti-BDNF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human BDNF, aa1-255 (NP_733927.1).
Immunogen Sequence
MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF polyclonal antibody. Lane 1: BDNF transfected lysate (28.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BDNF expression in transfected 293T cell line by BDNF polyclonal antibody. Lane 1: BDNF transfected lysate (28.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between BDNF and NTF4 HeLa cells were stained with BDNF rabbit purified polyclonal 1:1200 and NTF4 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between BDNF and NTF4 HeLa cells were stained with BDNF rabbit purified polyclonal 1:1200 and NTF4 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-BDNF antibody
BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this protein is reduced in both Alzheimer's and Huntington disease patients. This protein may play a role in the regulation of stress response and in the biology of mood disorders.
Product Categories/Family for anti-BDNF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
627
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
brain-derived neurotrophic factor isoform b
NCBI Official Synonym Full Names
brain derived neurotrophic factor
NCBI Official Symbol
BDNF
NCBI Official Synonym Symbols
ANON2; BULN2
NCBI Protein Information
brain-derived neurotrophic factor
UniProt Protein Name
Brain-derived neurotrophic factor
UniProt Gene Name
BDNF
UniProt Synonym Gene Names
BDNF
UniProt Entry Name
BDNF_HUMAN

NCBI Description

This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015]

Uniprot Description

BDNF: During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. Belongs to the NGF-beta family. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: Secreted, signal peptide; Cytokine; Cell development/differentiation; Secreted

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: extracellular space; synaptic vesicle; mitochondrial crista; perinuclear region of cytoplasm; cytoplasmic membrane-bound vesicle; cytoplasm; dendrite; extracellular region; terminal button; perikaryon

Molecular Function: growth factor activity; neurotrophin TRKB receptor binding

Biological Process: circadian rhythm; axon guidance; mechanoreceptor differentiation; behavioral fear response; mitochondrial electron transport, NADH to ubiquinone; regulation of neuron differentiation; axon extension; response to hormone stimulus; positive regulation of long-term neuronal synaptic plasticity; response to vitamin A; negative regulation of neuroblast proliferation; ureteric bud development; dendrite development; regulation of retinal cell programmed cell death; feeding behavior; negative regulation of neuron apoptosis; response to electrical stimulus; negative regulation of synaptic transmission, GABAergic; inner ear development; response to food; nervous system development; chronic inflammatory response; response to light intensity; neuron recognition; learning; regulation of short-term neuronal synaptic plasticity; regulation of axon extension; negative regulation of striated muscle development; positive regulation of peptidyl-serine phosphorylation; positive regulation of synaptogenesis; axon target recognition; response to hyperoxia; glutamate secretion; response to hypoxia; response to fluoxetine; nerve development; response to activity; regulation of excitatory postsynaptic membrane potential; positive regulation of neuron differentiation; neurite morphogenesis; transmembrane receptor protein tyrosine kinase signaling pathway; gamma-aminobutyric acid signaling pathway

Disease: Bulimia Nervosa, Susceptibility To, 1; Obsessive-compulsive Disorder; Bulimia Nervosa, Susceptibility To, 2; Central Hypoventilation Syndrome, Congenital

Research Articles on BDNF

Similar Products

Product Notes

The BDNF bdnf (Catalog #AAA6371203) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BDNF (Brain-derived Neurotrophic Factor, Abrineurin) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BDNF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BDNF bdnf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BDNF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.