Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-BCL2 Polyclonal Antibody)

Rabbit BCL2 Polyclonal Antibody | anti-BCL2 antibody

BCL2 Polyclonal Antibody

Gene Names
BCL2; Bcl-2; PPP1R50
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
BCL2; Polyclonal Antibody; BCL2 Polyclonal Antibody; Bcl-2; PPP1R50; apoptosis regulator Bcl-2; anti-BCL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.36 mg/ml (varies by lot)
Sequence Length
239
Applicable Applications for anti-BCL2 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BCL2 (NP_000624.2).
Immunogen Sequence
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
Positive Samples
293T, HeLa, Mouse Lung, Mouse Testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-BCL2 Polyclonal Antibody)

Western Blot (WB) (Western blot-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunohistochemistry (IHC) (Immunohistochemistry-BCL2 Polyclonal Antibody)

Immunofluorescence (IF)

(Immunofluorescence-BCL2 Polyclonal Antibody)

Immunofluorescence (IF) (Immunofluorescence-BCL2 Polyclonal Antibody)

Immunofluorescence (IF)

(Immunofluorescence-BCL2 Polyclonal Antibody)

Immunofluorescence (IF) (Immunofluorescence-BCL2 Polyclonal Antibody)

Immunofluorescence (IF)

(Immunofluorescence-BCL2 Polyclonal Antibody)

Immunofluorescence (IF) (Immunofluorescence-BCL2 Polyclonal Antibody)
Related Product Information for anti-BCL2 antibody
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
596
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 22kDa; 26kDa
Observed: 26kDa
NCBI Official Full Name
apoptosis regulator Bcl-2 isoform alpha
NCBI Official Synonym Full Names
BCL2 apoptosis regulator
NCBI Official Symbol
BCL2
NCBI Official Synonym Symbols
Bcl-2; PPP1R50
NCBI Protein Information
apoptosis regulator Bcl-2
UniProt Protein Name
Apoptosis regulator Bcl-2
UniProt Gene Name
BCL2
UniProt Entry Name
BCL2_HUMAN

NCBI Description

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

Bcl-2: a antiapoptotic member of the Bcl-2 family. Regulates cell death by controlling the mitochondrial membrane permeability. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Phosphorylation by JNKs may increase its antiapoptotic functions.

Protein type: Membrane protein, integral; Oncoprotein; Autophagy; Apoptosis

Chromosomal Location of Human Ortholog: 18q21.3

Cellular Component: pore complex; endoplasmic reticulum membrane; mitochondrial outer membrane; nuclear membrane; membrane; mitochondrion; endoplasmic reticulum; cytoplasm; nucleus; cytosol; myelin sheath

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; protease binding; protein phosphatase 2A binding; sequence-specific DNA binding; channel activity; protein heterodimerization activity; ubiquitin protein ligase binding; BH3 domain binding; channel inhibitor activity; transcription factor binding

Biological Process: focal adhesion formation; response to nicotine; positive regulation of catalytic activity; developmental growth; renal system process; pigment granule organization and biogenesis; protein polyubiquitination; response to toxin; response to glucocorticoid stimulus; T cell differentiation in the thymus; ear development; lymphoid progenitor cell differentiation; female pregnancy; positive regulation of multicellular organism growth; glomerulus development; negative regulation of mitochondrial depolarization; post-embryonic development; cochlear nucleus development; cellular response to glucose starvation; B cell receptor signaling pathway; negative regulation of myeloid cell apoptosis; regulation of mitochondrial membrane potential; negative regulation of ossification; positive regulation of B cell proliferation; regulation of transmembrane transporter activity; T cell homeostasis; negative regulation of neuron apoptosis; cell growth; defense response to virus; spleen development; response to drug; positive regulation of neuron maturation; release of cytochrome c from mitochondria; axon regeneration; regulation of protein homodimerization activity; actin filament organization; cell aging; digestive tract morphogenesis; regulation of calcium ion transport; positive regulation of cell growth; organ growth; induction of apoptosis via death domain receptors; DNA damage response, signal transduction resulting in induction of apoptosis; negative regulation of osteoblast proliferation; gland morphogenesis; regulation of mitochondrial membrane permeability; regulation of nitrogen utilization; metanephros development; oocyte development; negative regulation of apoptosis; B cell proliferation; negative regulation of autophagy; regulation of protein heterodimerization activity; behavioral fear response; melanin metabolic process; apoptosis; regulation of cell-matrix adhesion; negative regulation of retinal cell programmed cell death; regulation of protein stability; protein amino acid dephosphorylation; positive regulation of smooth muscle cell migration; response to radiation; B cell homeostasis; ovarian follicle development; positive regulation of skeletal muscle fiber development; positive regulation of melanocyte differentiation; melanocyte differentiation; response to gamma radiation; negative regulation of cell migration; regulation of viral genome replication; response to iron ion; transmembrane transport; negative regulation of cellular pH reduction; mesenchymal cell development; ossification; hair follicle morphogenesis; CD8-positive, alpha-beta T cell lineage commitment; thymus development; B cell lineage commitment; male gonad development; peptidyl-threonine phosphorylation; positive regulation of peptidyl-serine phosphorylation; humoral immune response; response to UV-B; endoplasmic reticulum calcium ion homeostasis; neuron apoptosis; peptidyl-serine phosphorylation; response to hydrogen peroxide; axonogenesis; ureteric bud branching; homeostasis of number of cells within a tissue; response to cytokine stimulus; innate immune response; negative regulation of cell growth; response to DNA damage stimulus; induction of apoptosis by oxidative stress

Research Articles on BCL2

Similar Products

Product Notes

The BCL2 bcl2 (Catalog #AAA9140985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BCL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the BCL2 bcl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.