Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of Bcl-2 using anti-Bcl-2 antibody (MBS1750313). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysate,Lane 2: mouse thymus tissue lysate,Lane 3: human MCF-7 whole Cell lysate,Lane 4: human 22RV1 whole Cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Bcl-2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Bcl-2 at approximately 29KD. The expected band size for Bcl-2 is at 26KD. )

Rabbit Bcl-2 Polyclonal Antibody | anti-Bcl-2 antibody

Anti-Bcl-2 Picoband Antibody

Gene Names
BCL2; Bcl-2; PPP1R50
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Flow Cytometry, Functional Assay, Immunohistochemistry, Immunocytochemistry, Western Blot
Purity
Immunogen affinity purified
Synonyms
Bcl-2; Polyclonal Antibody; Anti-Bcl-2 Picoband Antibody; Apoptosis regulator Bcl-2; BCL2; anti-Bcl-2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Purity/Purification
Immunogen affinity purified
Form/Format
Lyophilized
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (varies by lot)
Sequence Length
205
Applicable Applications for anti-Bcl-2 antibody
Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blot (WB)
Application Notes
WB: 0.1-0.5mug/ml
Immunohistochemistry(Frozen Section): 0.5-1mug/ml
ICC: 0.5-1mug/ml
FC/FACS: 1-3g/1x10 6 cells
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.
Subcellular Localization
Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in a variety of tissues.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of Bcl-2 using anti-Bcl-2 antibody (MBS1750313). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysate,Lane 2: mouse thymus tissue lysate,Lane 3: human MCF-7 whole Cell lysate,Lane 4: human 22RV1 whole Cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Bcl-2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Bcl-2 at approximately 29KD. The expected band size for Bcl-2 is at 26KD. )

Western Blot (WB) (Figure 1. Western blot analysis of Bcl-2 using anti-Bcl-2 antibody (MBS1750313). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysate,Lane 2: mouse thymus tissue lysate,Lane 3: human MCF-7 whole Cell lysate,Lane 4: human 22RV1 whole Cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Bcl-2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Bcl-2 at approximately 29KD. The expected band size for Bcl-2 is at 26KD. )
Related Product Information for anti-Bcl-2 antibody
Description: Immunoreactive BCL2 protein in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t(14; 18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line.
Protein Function: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
596
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26266 MW
NCBI Official Full Name
apoptosis regulator Bcl-2 alpha isoform
NCBI Official Synonym Full Names
BCL2, apoptosis regulator
NCBI Official Symbol
BCL2
NCBI Official Synonym Symbols
Bcl-2; PPP1R50
NCBI Protein Information
apoptosis regulator Bcl-2
UniProt Protein Name
Apoptosis regulator Bcl-2
Protein Family
UniProt Gene Name
BCL2

NCBI Description

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Uniprot Description

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).

Research Articles on Bcl-2

Similar Products

Product Notes

The Bcl-2 bcl2 (Catalog #AAA1750313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Bcl-2 Picoband Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Bcl-2 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blot (WB). WB: 0.1-0.5mug/ml Immunohistochemistry(Frozen Section): 0.5-1mug/ml ICC: 0.5-1mug/ml FC/FACS: 1-3g/1x10 6 cells. Researchers should empirically determine the suitability of the Bcl-2 bcl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Bcl-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.