Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BCAT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Rabbit BCAT1 Polyclonal Antibody | anti-BCAT1 antibody

BCAT1 antibody - N-terminal region

Gene Names
BCAT1; BCT1; PP18; BCATC; ECA39; MECA39; PNAS121
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCAT1; Polyclonal Antibody; BCAT1 antibody - N-terminal region; anti-BCAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG
Sequence Length
386
Applicable Applications for anti-BCAT1 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 100%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BCAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BCAT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-BCAT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)
Related Product Information for anti-BCAT1 antibody
This is a rabbit polyclonal antibody against BCAT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clin
Product Categories/Family for anti-BCAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
586
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
branched-chain-amino-acid aminotransferase, cytosolic isoform 1
NCBI Official Synonym Full Names
branched chain amino acid transaminase 1
NCBI Official Symbol
BCAT1
NCBI Official Synonym Symbols
BCT1; PP18; BCATC; ECA39; MECA39; PNAS121
NCBI Protein Information
branched-chain-amino-acid aminotransferase, cytosolic
UniProt Protein Name
Branched-chain-amino-acid aminotransferase, cytosolic
UniProt Gene Name
BCAT1
UniProt Synonym Gene Names
BCT1; ECA39; BCAT(c)
UniProt Entry Name
BCAT1_HUMAN

NCBI Description

This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described. [provided by RefSeq, May 2010]

Uniprot Description

BCAT1: Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.6.1.42; Amino Acid Metabolism - valine, leucine and isoleucine biosynthesis; Cofactor and Vitamin Metabolism - pantothenate and CoA biosynthesis; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Transferase

Chromosomal Location of Human Ortholog: 12p12.1

Cellular Component: mitochondrion; cytosol

Molecular Function: identical protein binding; branched-chain-amino-acid transaminase activity

Biological Process: cell proliferation; branched chain family amino acid catabolic process; branched chain family amino acid biosynthetic process; G1/S transition of mitotic cell cycle

Research Articles on BCAT1

Similar Products

Product Notes

The BCAT1 bcat1 (Catalog #AAA3208075) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCAT1 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's BCAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCAT1 bcat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKDCSNGCSA ECTGEGGSKE VVGTFKAKDL IVTPATILKE KPDPNNLVFG. It is sometimes possible for the material contained within the vial of "BCAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.