Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-BAX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit BAX Polyclonal Antibody | anti-BAX antibody

BAX antibody - N-terminal region

Gene Names
BAX; BCL2L4
Reactivity
Human, Frog
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
BAX; Polyclonal Antibody; BAX antibody - N-terminal region; anti-BAX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Frog
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGD
Sequence Length
218
Applicable Applications for anti-BAX antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 91%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BAX
Protein Size
218 amino acids
Protein Interactions
CYCS; ZBTB24; UBC; CASP9; CASP8; CASP7; CASP3; BCL2L1; BCL2; CLU; MDM2; MCL1; BAX; BAG3; YWHAB; VCP; CRYAB; CRYAA; BAK1; XIAP; TP53; KCNA3; HSPA4; XRCC6; XRCC5; HDAC6; BAD; PSMC5; PSMC3; PARK7; UHRF2; RNF144B; OYE2; TOMM22; TOMM40; MEPCE; MOAP1; BBC3; PPP
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-BAX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-BAX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Researcher: Rosa Carotenuto, Department of Structural and Functional Biology, University of Naples 'Federico II'Application: Western blottingSpecies + Tissue/Cell type: xenopus laevis embryosHow many ug's of tissue/cell lysate run on the gel: 1. 50 ug xenopus laevis embryos lysate (lysate buffer) 2. 50 ug xenopus laevis embryos lysate (HB buffer)Primary antibody dilution: 1:400Secondary antibody: Goat Anti-Rabbit APSecondary antibody dilution: 1:20000)

Western Blot (WB) (Researcher: Rosa Carotenuto, Department of Structural and Functional Biology, University of Naples 'Federico II'Application: Western blottingSpecies + Tissue/Cell type: xenopus laevis embryosHow many ug's of tissue/cell lysate run on the gel: 1. 50 ug xenopus laevis embryos lysate (lysate buffer) 2. 50 ug xenopus laevis embryos lysate (HB buffer)Primary antibody dilution: 1:400Secondary antibody: Goat Anti-Rabbit APSecondary antibody dilution: 1:20000)

Western Blot (WB)

(WB Suggested Anti-BAX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-BAX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-BAX antibody
This is a rabbit polyclonal antibody against BAX. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
581
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
apoptosis regulator BAX isoform beta
NCBI Official Synonym Full Names
BCL2 associated X, apoptosis regulator
NCBI Official Symbol
BAX
NCBI Official Synonym Symbols
BCL2L4
NCBI Protein Information
apoptosis regulator BAX
UniProt Protein Name
Apoptosis regulator BAX
Protein Family
UniProt Gene Name
BAX
UniProt Synonym Gene Names
BCL2L4; Bcl2-L-4
UniProt Entry Name
BAX_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

BAX: Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. Homodimer. Forms higher oligomers under stress conditions. Interacts with BCL2L11. Interaction with BCL2L11 promotes BAX oligomerization and association with mitochondrial membranes, with subsequent release of cytochrome c. Forms heterodimers with BCL2, E1B 19K protein, BCL2L1 isoform Bcl-X(L), BCL2L2, MCL1 and A1. Interacts with SH3GLB1 and HN. Interacts with SFN and YWHAZ; the interaction occurs in the cytoplasm. Under stress conditions, JNK-mediated phosphorylation of SFN and YWHAZ, releases BAX to mitochondria. Isoform Sigma interacts with BCL2A1 and BCL2L1 isoform Bcl-X(L). Interacts with RNF144B, which regulates the ubiquitin-dependent stability of BAX. Interacts with CLU under stress conditions that cause a conformation change leading to BAX oligomerization and association with mitochondria. Does not interact with CLU in unstressed cells. Interacts with FAIM2/LFG2. Interacts with human cytomegalovirus/HHV-5 protein vMIA/UL37. Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro- myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T- cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines. Belongs to the Bcl-2 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Mitochondrial; Membrane protein, integral; Apoptosis

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: mitochondrial permeability transition pore complex; pore complex; endoplasmic reticulum membrane; mitochondrial outer membrane; mitochondrion; membrane; endoplasmic reticulum; nuclear envelope; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; protein heterodimerization activity; channel activity; BH3 domain binding; lipid binding

Biological Process: hypothalamus development; viral reproduction; regulation of cell cycle; positive regulation of apoptosis; response to toxin; germ cell programmed cell death; myeloid cell homeostasis; B cell apoptosis; germ cell development; regulation of mammary gland epithelial cell proliferation; spermatid differentiation; regulation of mitochondrial membrane potential; development of secondary sexual characteristics; protein insertion into mitochondrial membrane during induction of apoptosis; establishment and/or maintenance of transmembrane electrochemical gradient; negative regulation of neuron apoptosis; negative regulation of protein binding; kidney development; release of cytochrome c from mitochondria; positive regulation of B cell apoptosis; regulation of protein homodimerization activity; vagina development; protein oligomerization; fertilization; unfolded protein response, activation of signaling protein activity; induction of apoptosis via death domain receptors; DNA damage response, signal transduction resulting in induction of apoptosis; retina development in camera-type eye; negative regulation of fibroblast proliferation; reduction of endoplasmic reticulum calcium ion concentration; glycosphingolipid metabolic process; cerebral cortex development; mitochondrial fragmentation during apoptosis; regulation of nitrogen utilization; post-embryonic camera-type eye morphogenesis; positive regulation of pigmentation; regulation of protein heterodimerization activity; T cell homeostatic proliferation; apoptosis; negative regulation of peptidyl-serine phosphorylation; positive regulation of apoptosis involved in mammary gland involution; neuron migration; release of matrix enzymes from mitochondria; response to salt stress; positive regulation of protein oligomerization; apoptotic mitochondrial changes; B cell homeostatic proliferation; B cell homeostasis; ovarian follicle development; positive regulation of neuron apoptosis; response to gamma radiation; B cell negative selection; response to axon injury; protein homooligomerization; caspase activation; transformed cell apoptosis; mitochondrial fusion; Sertoli cell proliferation; odontogenesis of dentine-containing teeth; endoplasmic reticulum calcium ion homeostasis; neuron apoptosis; homeostasis of number of cells within a tissue; blood vessel remodeling; retinal cell programmed cell death; positive regulation of release of sequestered calcium ion into cytosol; caspase activation via cytochrome c

Research Articles on BAX

Similar Products

Product Notes

The BAX bax (Catalog #AAA3214086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAX antibody - N-terminal region reacts with Human, Frog Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's BAX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the BAX bax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IMKTGALLLQ GFIQDRAGRM GGEAPELALD PVPQDASTKK LSECLKRIGD. It is sometimes possible for the material contained within the vial of "BAX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.