Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 polyclonal antibody. Lane 1: SNFT transfected lysate (13.97kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human BATF3 Polyclonal Antibody | anti-Batf3 antibody

BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21 kDa Small Nuclear Factor Isolated from T-cells, SNFT, Jun Dimerization Protein p21SNFT, JDP1, JUNDM1)

Gene Names
Batf3; Snft; 9130211I03Rik
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BATF3; Polyclonal Antibody; BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3; B-ATF-3; 21 kDa Small Nuclear Factor Isolated from T-cells; SNFT; Jun Dimerization Protein p21SNFT; JDP1; JUNDM1); Anti -BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3; anti-Batf3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SNFT.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Applicable Applications for anti-Batf3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SNFT, aa1-127 (NP_061134.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 polyclonal antibody. Lane 1: SNFT transfected lysate (13.97kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BATF3 expression in transfected 293T cell line by BATF3 polyclonal antibody. Lane 1: SNFT transfected lysate (13.97kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-Batf3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,657 Da
NCBI Official Full Name
basic leucine zipper transcriptional factor ATF-like 3
NCBI Official Synonym Full Names
basic leucine zipper transcription factor, ATF-like 3
NCBI Official Symbol
Batf3
NCBI Official Synonym Symbols
Snft; 9130211I03Rik
NCBI Protein Information
basic leucine zipper transcriptional factor ATF-like 3; B-ATF-3; Jun dimerization protein p21SNFT
UniProt Protein Name
Basic leucine zipper transcriptional factor ATF-like 3
UniProt Gene Name
Batf3
UniProt Synonym Gene Names
B-ATF-3
UniProt Entry Name
BATF3_MOUSE

Uniprot Description

Function: AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens. Ref.3 Ref.4 Ref.6

Subunit structure: Heterodimer; heterodimerizes with JUN family proteins. Interacts with JUN.

Subcellular location: Nucleus

By similarity.

Tissue specificity: Highly expressed in CD8-alpha+ classical dendritic cells (cDCs), with low to absent expression in other immune cells and non-immune tissues. Ref.3

Disruption phenotype: Selective loss of CD8-alpha+ classical dendritic cells (cDCs) and CD103+ dendritic cells, without abnormalities in other hematopoietic cell types or architecture. Dendritic cells are defective in cross-presentation, and mice lack virus-specific CD8+ T-cell responses to West Nile virus. Mice also show reduced priming of CD8 T-cells after pulmonary Sendai virus infection, with increased pulmonary inflammation. Mice are extremely susceptible to T.gondii infection, with decreased production of interleukin-12 (IL12) and interferon-gamma. In contrast, mice are more resistant to L.monocytogenes infection. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7

Miscellaneous: The increased protection toward L.monocytogenes infection in mice lacking Batf3 suggests that CD8-alpha+ classical dendritic cells (cDCs) and CD103+ dendritic cells are an entry point for infection by L.monocytogenes (Ref.5).

Sequence similarities: Belongs to the bZIP family.Contains 1 bZIP (basic-leucine zipper) domain.

Research Articles on Batf3

Similar Products

Product Notes

The Batf3 batf3 (Catalog #AAA649670) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The BATF3 (Basic Leucine Zipper Transcriptional Factor ATF-like 3, B-ATF-3, 21 kDa Small Nuclear Factor Isolated from T-cells, SNFT, Jun Dimerization Protein p21SNFT, JDP1, JUNDM1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BATF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Batf3 batf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQGLPAAGS VLQRSVAAPG NQPQPQPQQQ SPEDDDRKVR RREKNRVAAQ RSRKKQTQKA DKLHEEYESL EQENTMLRRE IGKLTEELKH LTEALKEHEK MCPLLLCPMN FVPVPPRPDP VAGCLPR. It is sometimes possible for the material contained within the vial of "BATF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.