Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BATF expression in transfected 293T cell line by BATF polyclonal antibody. Lane 1: BATF transfected lysate (14.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human BATF Polyclonal Antibody | anti-BATF antibody

BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (Biotin)

Gene Names
BATF; SFA2; B-ATF; BATF1; SFA-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
BATF; Polyclonal Antibody; BATF (Basic Leucine Zipper Transcriptional Factor ATF-like; B Cell-activating Transcription Factor; SF-HT-activated Gene 2 Protein) (Biotin); anti-BATF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BATF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-BATF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human BATF, aa1-125 (NP_006390.1).
Immunogen Sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BATF expression in transfected 293T cell line by BATF polyclonal antibody. Lane 1: BATF transfected lysate (14.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BATF expression in transfected 293T cell line by BATF polyclonal antibody. Lane 1: BATF transfected lysate (14.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BATF antibody
The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.
Product Categories/Family for anti-BATF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,120 Da
NCBI Official Full Name
basic leucine zipper transcriptional factor ATF-like
NCBI Official Synonym Full Names
basic leucine zipper transcription factor, ATF-like
NCBI Official Symbol
BATF
NCBI Official Synonym Symbols
SFA2; B-ATF; BATF1; SFA-2
NCBI Protein Information
basic leucine zipper transcriptional factor ATF-like; SF-HT-activated gene 2 protein; activating transcription factor B; B-cell-activating transcription factor
UniProt Protein Name
Basic leucine zipper transcriptional factor ATF-like
UniProt Gene Name
BATF
UniProt Synonym Gene Names
B-ATF; SFA-2
UniProt Entry Name
BATF_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq, Jul 2008]

Uniprot Description

BATF: a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. Functions as a negative regulator of AP-1 mediated transcription by binding to Jun proteins. Jun/B-ATF heterodimers bind DNA preferentially at the 12-O-tetradecanoylphorbol-13- acetate response element (TRE) and weaker at the cAMP responsive region (CRE), but are transcriptionally inert.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; DNA damage response, signal transduction by p53 class mediator; isotype switching; cytokine production; lymphoid progenitor cell differentiation; myeloid dendritic cell differentiation; T-helper 2 cell differentiation; defense response to protozoan; response to DNA damage stimulus

Research Articles on BATF

Similar Products

Product Notes

The BATF batf (Catalog #AAA6371015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BATF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the BATF batf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BATF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.