Rabbit BAG4 Polyclonal Antibody | anti-BAG4 antibody

BAG4 Rabbit pAb

Cat. Num. AAA9142596

• Gene Names: BAG4; SODD; BAG-4
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity purification
• Synonyms: BAG4; Polyclonal Antibody; BAG4 Rabbit pAb; BAG-4; SODD; anti-BAG4 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQSLNSYTNGAY

• Applicable Applications for anti-BAG4 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BAG4 (NP_001191807.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using BAG4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Related Product Information for anti-BAG4 antibody

Background: The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 325910869
• NCBI GeneID: 9530
• NCBI Accession #: NP_001191807.1
• NCBI GenBank Nucleotide #: NM_001204878.1
• UniProt Accession #: O95429; O95818; B4E217
• Molecular Weight: 49,594 Da
• NCBI Official Full Name: BAG family molecular chaperone regulator 4 isoform 2
• NCBI Official Synonym Full Names: BCL2-associated athanogene 4
• NCBI Official Symbol: BAG4
• NCBI Official Synonym Symbols: SODD; BAG-4
• NCBI Protein Information: BAG family molecular chaperone regulator 4; silencer of death domains; bcl-2-associated athanogene 4; BAG-family molecular chaperone regulator-4
• UniProt Protein Name: BAG family molecular chaperone regulator 4
• Protein Family: BAG family molecular chaperone regulator
• UniProt Gene Name: BAG4
• UniProt Synonym Gene Names: SODD; BAG-4
• UniProt Entry Name: BAG4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011]

Uniprot Description

BAG4: Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. Prevents constitutive TNFRSF1A signaling. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 8p11.23

Cellular Component: plasma membrane; nucleus; cytosol

Molecular Function: protein binding; chaperone binding; receptor signaling protein activity

Biological Process: positive regulation of protein kinase B signaling cascade; positive regulation of cell adhesion; protein folding; positive regulation of actin filament polymerization; protein heterooligomerization; positive regulation of stress fiber formation; positive regulation of peptidyl-serine phosphorylation; negative regulation of apoptosis