Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '20207'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.83 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '20207' and pd.language_id = 1
Query
Database
1.59 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '20207'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
1.82 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '20207'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '20207' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '20207'
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 2-8 degree C for one month. <br>Aliquot and store at -80 degree C for 12 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (57) "Positive Control; Immunogen; SDS-PAGE; Western Blot (WB)."
$value['app_tested']
⇄app_notes => string (75) "(May be suitable for use in other assays to be determined by the end user.)"
Traits||Freeze-dried powder!!Predicted isoelectric point||9.2!!Usage||Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 2-8 degree C for one month. <br>Aliquot and store at -80 degree C for 12 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (57) "Positive Control; Immunogen; SDS-PAGE; Western Blot (WB)."
$value->a['app_tested']
⇄app_notes => string (75) "(May be suitable for use in other assays to be determined by the end user.)"
Traits||Freeze-dried powder!!Predicted isoelectric point||9.2!!Usage||Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
<b>Storage:</b><br>Avoid repeated freeze/thaw cycles.<br>Store at 2-8 degree C for one month. <br>Aliquot and store at -80 degree C for 12 months.<br><br><b>Stability Test:</b><br>The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
⇄app_tested => string (57) "Positive Control; Immunogen; SDS-PAGE; Western Blot (WB)."
$value->d['app_tested']
⇄app_notes => string (75) "(May be suitable for use in other assays to be determined by the end user.)"
Traits||Freeze-dried powder!!Predicted isoelectric point||9.2!!Usage||Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
⇄⧉products_description => string (754) "Background: Glycogen synthase (EC 2.4.1.11) is a key enzyme in glycogenesis,...
$value[0]['_source']['products_description']
Background: Glycogen synthase (EC 2.4.1.11) is a key enzyme in glycogenesis, the conversion of glucose into glycogen. It is a glycosyltransferase that catalyses the reaction of UDP-glucose and (1,4-alpha-D-glucosyl)n to yield UDP and (1,4-alpha-D-glucosyl)n+1. In other words, this enzyme combines excess glucose residues one by one into a polymeric chain for storage as glycogen. Glycogen synthase concentration is highest in the bloodstream 30 to 60 minutes following intense exercise. Glycogen Synthase Microplate Assay Kit is a sensitive assay for determining Glycogen synthase activity in various samples. Glycogen synthase activity is determined by NADH decomposition rate. The reaction products can be measured at a colorimetric readout at 340 nm.
⇄products_references => string (3) "N/A"
$value[0]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[0]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[0]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[0]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[0]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[0]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[0]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[0]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[0]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[0]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[0]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[0]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[0]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[0]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[0]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[0]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[0]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[0]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[0]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[0]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[0]['_source']['products_viewed']
⇄⧉search_terms => string (428) "aaa27903 general functional assay fa typical testing data standard curve for...
$value[0]['_source']['search_terms']
aaa27903 general functional assay fa typical testing data standard curve for reference only representative aaa27903_sc kit glycogen synthase microplate ec 2.4.1.11 dp glucose glucosyltransferase starch synthetase udp udpg transglucosylase uridine diphosphoglucose sample types serum plasma tissue extracts cell lysate culture media other biological fluids detection method colorimetric range 4umol l 400umol cas number 9014 56 6
Homology||Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%!!Immunogen||The immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B
⇄⧉products_description => string (1134) "This is a rabbit polyclonal antibody against GSK3B. It was validated on West...
$value[1]['_source']['products_description']
This is a rabbit polyclonal antibody against GSK3B. It was validated on Western Blot using a cell lysate as a positive control.<br><br>Target Description: Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A) and beta, show a high degree of amino acid homology. GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A; MIM 606784) and beta, show a high degree of amino acid homology (Stambolic and Woodgett, 1994 [PubMed 7980435]). GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation (Plyte et al., 1992 [PubMed 1333807]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄⧉products_related_diseases => string (227) "Brain Diseases||19!!Nervous System Diseases||19!!Neoplasms||18!!Bipolar Diso...
⇄⧉search_terms => string (1316) "aaa23559 rabbit cow dog goat guinea pig horse human mouse rat sheep zebrafis...
$value[1]['_source']['search_terms']
aaa23559 rabbit cow dog goat guinea pig horse human mouse rat sheep zebrafish polyclonal affinity purified liquid antibody supplied in 1x pbs buffer with 0.09 w v sodium azide and 2 sucrose immunohistochemistry ihc western blot wb sample type brain cortex aaa23559_ihc anti gsk3b formalin fixed paraffin embedded tissue testis observed staining cytoplasm nucleus plasma membrane primary concentration 1:100 other working concentrations 1:600 secondary donkey cy3 1:200 magnification 20x exposure time 0.5 2.0 sec aaa23559_ihc2 host target name dilution 1ug ml aaa23559_wb3 aaa23559_wb4 hela 1.0ug mlgsk3b is supported by biogps gene expression data to be expressed aaa23559_wb5 fetal heart aaa23559_wb6 suggested titration 0.2 1 ug elisa titer 1:62500 positive control 721_b cell lysategsk3b aaa23559_wb7 synthetic peptide located within the following region aialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalfnf c terminal glycogen synthase kinase 3 beta isoform 48kda serine threonine protein gsk gsk3b_human 21361340 np_002084 p49841 nm_002093 605004 transcription factor signal proteins drugs drug metabolism chromatin nuclear signaling neuroscience disease related dna rna interactions phosphorylation differentiation homology 100 86 93 immunogen a directed towards of and2 time0.5 titration0.2 kinase3 homology100
ICC (Immunocytochemistry)||ICC staining Phospho-GSK3 (alpha+beta) (Y216+Y279) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29772_ICC6.jpg!!ICC (Immunocytochemistry)||ICC staining Phospho-GSK3 (alpha+beta) (Y216+Y279) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29772_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining Phospho-GSK3 (alpha+beta) (Y216+Y279) in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29772_ICC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti-Phospho-GSK3 (alpha+beta) (Y216+Y279) antibody. Counter stained with hematoxylin.||AAA29772_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-GSK3 (alpha+beta) (Y216+Y279) antibody. Counter stained with hematoxylin.||AAA29772_IHC2.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded rat brain tissue using anti-Phospho-GSK3 (alpha+beta) (Y216+Y279) antibody. Counter stained with hematoxylin.||AAA29772_IHC.jpg
Antibody Type||Recombinant Antibody!!Immunogen||Synthetic phospho-peptide corresponding to residues surrounding Tyr216 and 279 of human GSK3 (alpha+beta).
⇄⧉products_description => string (1368) "Glycogen synthase kinase-3alpha (GSK-3alpha) and GSK-3beta are highly simila...
$value[2]['_source']['products_description']
Glycogen synthase kinase-3alpha (GSK-3alpha) and GSK-3beta are highly similar isoforms of serine/ threonine kinases that regulate metabolic enzymes and transcription factors, which are responsible for coordinating processes such as glycogen synthesis and cell adhesion. GSK-3beta activity is also required for nuclear activity of Rel dimers, which mediate an anti-apoptotic response to TNFalpha in mice. GSK-3 catalytic kinase activity is controlled through differential phosphorylation of serine/threonine residues, which have an inhibitory effect, and tyrosine residues, which have an activating effect. Growth factor stimulation of mammalian cells expressing GSK-3alpha and GSK-3beta induces phosphorylation of Ser 21 and Ser 9, respectively, through a phosphatidylinositol 3-kinase (PI 3-K)-protein kinase B (PKB)-dependent pathway, thereby enhancing proliferative signals. Additionally, GSK-3 physically associates with cAMP-dependent protein kinase A (PKA), which phosphorylates Ser 21 of GSK-3alpha or Ser 9 of GSK-3beta and inactivates both forms. GSK-3alpha/beta is positively regulated by phosphorylation on Tyr 279 and Tyr 216, respectively. Activated GSK-3alpha/beta participates in energy metabolism, neuronal cell development, and body pattern formation. Tyrosine dephosphorylation of GSK-3 is involved in its extracellular signal-dependent inactivation.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (156) "Fibrosis||2!!Cardiovascular Diseases||2!!Neoplasms||2!!Nervous System Diseas...
$value[2]['_source']['products_related_diseases']
Fibrosis||2!!Cardiovascular Diseases||2!!Neoplasms||2!!Nervous System Diseases||2!!Brain Diseases||1!!Liver Diseases||1!!Heart Diseases||1!!Schizophrenia||1
⇄⧉ncbi_pathways => string (483) "AKT Phosphorylates Targets In The Cytosol Pathway||106475!!Activation Of Cha...
$value[2]['_source']['ncbi_pathways']
AKT Phosphorylates Targets In The Cytosol Pathway||106475!!Activation Of Chaperone Genes By XBP1(S) Pathway||530771!!Activation Of Chaperones By IRE1alpha Pathway||105906!!Adaptive Immune System Pathway||366160!!B Cell Receptor Signaling Pathway||198909!!Chemokine Signaling Pathway||99051!!Chemokine Signaling Pathway||96864!!Class I PI3K Signaling Events Mediated By Akt Pathway||138020!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549
⇄⧉testing_protocols => string (1584) "WB (Western Blot)||Western blot analysis of extracts of various celllines, u...
$value[3]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of extracts of various celllines, using GSK3 alpha/beta Antibody.||AAA31094_WB6.jpg!!IHC (Immunohistochemistry)||AAA31094 at 1/50 staining human brain tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31094_IHC5.jpg!!IHC (Immunohistochemistry)||AAA31094 at 1/50 staining human brain tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31094_IHC4.jpg!!IHC (Immunohistochemistry)||AAA31094 at 1/50 staining human brain tissue sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-rabbit antibody was used as the secondary.||AAA31094_IHC3.jpg!!WB (Western Blot)||Western blot analysis of GSK3 alpha/beta expression in TNF-a treated 293 whole cell lysates, The lane on the left is treated with the antigen-specific peptide.||AAA31094_WB2.jpg!!WB (Western Blot)||Western blot analysis of extracts from 293, using GSK3 alpha/beta Antibody.||AAA31094_WB.jpg
⇄⧉etc_term1 => string (278) "Immunogen||A synthesized peptide derived from human GSK3 alpha/beta!!Subcell...
$value[3]['_source']['etc_term1']
Immunogen||A synthesized peptide derived from human GSK3 alpha/beta!!Subcellular Location||Cytoplasmic and Nuclear!!<font color="black">Predicted Cross Reactivity</font>||<b>Pig, Bovine, Chicken, Xenopus</b>!!Similarity||Pig (100%), Bovine (100%), Chicken (100%), Xenopus (100%)
⇄⧉products_description => string (2124) "Description: GSK3A a proline-directed protein kinase of the GSK family. Impl...
$value[3]['_source']['products_description']
Description: GSK3A a proline-directed protein kinase of the GSK family. Implicated in the control of several regulatory proteins including glycogen synthase, Myb, and c-Jun. GSK3 and GSK3 have similar functions. GSK3 phophorylates tau, the principal component of neurofibrillary tangles in Alzheimer disease and is required for maximal production of amyloid plaque peptides by secretase.<br>Function: Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation.<br>Subunit Structure: Monomer. Interacts with ARRB2 (By similarity). Interacts with AXIN1 and CTNNB1/beta-catenin. Interacts with CTNND2 (PubMed:19706605).<br>Post-translational Modifications: Phosphorylated by AKT1 at Ser-21: upon insulin-mediated signaling, the activated PKB/AKT1 protein kinase phosphorylates and desactivates GSK3A, resulting in the dephosphorylation and activation of GYS1. Activated by phosphorylation at Tyr-279.<br>Similarity: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. GSK-3 subfamily.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (156) "Fibrosis||2!!Cardiovascular Diseases||2!!Neoplasms||2!!Nervous System Diseas...
$value[3]['_source']['products_related_diseases']
Fibrosis||2!!Cardiovascular Diseases||2!!Neoplasms||2!!Nervous System Diseases||2!!Brain Diseases||1!!Liver Diseases||1!!Heart Diseases||1!!Schizophrenia||1
⇄⧉ncbi_pathways => string (483) "AKT Phosphorylates Targets In The Cytosol Pathway||106475!!Activation Of Cha...
$value[3]['_source']['ncbi_pathways']
AKT Phosphorylates Targets In The Cytosol Pathway||106475!!Activation Of Chaperone Genes By XBP1(S) Pathway||530771!!Activation Of Chaperones By IRE1alpha Pathway||105906!!Adaptive Immune System Pathway||366160!!B Cell Receptor Signaling Pathway||198909!!Chemokine Signaling Pathway||99051!!Chemokine Signaling Pathway||96864!!Class I PI3K Signaling Events Mediated By Akt Pathway||138020!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549
⇄⧉testing_protocols => string (1533) "FCM (Flow Cytometry)||Flow cytometric analysis of 293 cells with Glycogen sy...
$value[4]['_source']['testing_protocols']
FCM (Flow Cytometry)||Flow cytometric analysis of 293 cells with Glycogen synthase antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.||AAA30169_FCM7.jpg!!ICC (Immunocytochemistry)||ICC staining Glycogen synthase in NIH-3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30169_ICC6.jpg!!ICC (Immunocytochemistry)||ICC staining Glycogen synthase in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30169_ICC5.jpg!!ICC (Immunocytochemistry)||ICC staining Glycogen synthase in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA30169_ICC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse prostate tissue using anti-Glycogen synthase antibody. Counter stained with hematoxylin.||AAA30169_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Glycogen synthase antibody. Counter stained with hematoxylin.||AAA30169_IHC2.jpg!!WB (Western Blot)||Western blot analysis of Glycogen synthase on Hela lysates using anti- Glycogen synthase antibody at 1/1, 000 dilution.||AAA30169_WB.jpg
⇄⧉products_description => string (900) "Glycogen [starch] synthase belongs to the mammalian/fungal glycogen synthase...
$value[4]['_source']['products_description']
Glycogen [starch] synthase belongs to the mammalian/fungal glycogen synthase family of proteins. Two forms of this protein exist, a liver form and a muscle form, both of which have the same function in the glycogen biosynthesis pathway. Glycogen synthase transfers the glycosyl residue from UDP-Glucose to the nonreducing end of alpha-1, 4-glucan. The liver glycogen synthase protein is truncated by 34 amino acids compared to the muscle form. However, these enzymes differ significantly in their amino- and carboxyl-terminal regions. Muscle glycogen synthase serves to fuel muscular activity only and is regulated by muscle contraction and by catecholamines. Liver glycogen synthase mediates blood glucose homeostasis in response to nutritional cues. Defects in the gene encoding liver glycogen synthase results in glycogen storage disease type 0 (GSD0), a rare form of fasting ketotic hypoglycemia.
⇄⧉search_terms => string (1067) "aaa30169 rabbit human mouse rat monoclonal sn75 05 proa affinity purified 1*...
$value[4]['_source']['search_terms']
aaa30169 rabbit human mouse rat monoclonal sn75 05 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunofluorescence if immunohistochemistry ihc immunoprecipitation ip flow cytometry fc facs 1:1000 1:50 1:200 1:100 analysis of glycogen synthase on hela lysates using anti antibody at 000 dilution aaa30169_wb immunohistochemical paraffin embedded skeletal muscle tissue counter stained with hematoxylin aaa30169_ihc2 prostate aaa30169_ihc3 staining in pc 3m cells green the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa30169_icc4 aaa30169_icc5 nih 3t3 aaa30169_icc6 cytometric 293 50 red compared an unlabelled control without incubation primary black alexa fluor 488 conjugated goat igg was used as secondary aaa30169_fc7 starch gsy gys gys1 gys1_human 83,786 da 239049591 np_001155059.1 p13807 nm_001161587.1 q9btt9 138570 total protein ab type recombinant immunogen conjugation unconjugated sn7505 ph7.41 bsa40 at000 cytometric293 fluor488
ICC (Immunocytochemistry)||ICC staining Phospho-Glycogen synthase 1 (S641) in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29768_ICC6.jpg!!ICC (Immunocytochemistry)||ICC staining Phospho-Glycogen synthase 1 (S641) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29768_ICC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse smooth muscle tissue using anti-Phospho-Glycogen synthase 1 (S641) antibody. Counter stained with hematoxylin.||AAA29768_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Phospho-Glycogen synthase 1 (S641) antibody. Counter stained with hematoxylin.||AAA29768_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse liver tissue using anti-Phospho-Glycogen synthase 1 (S641) antibody. Counter stained with hematoxylin.||AAA29768_IHC2.jpg!!WB (Western Blot)||Western blot analysis of Phospho-Glycogen synthase 1 (S641) on different lysates using anti-Phospho-Glycogen synthase 1 (S641) antibody at 1/1, 000 dilution. Positive control: Lane 1: Mouse liver lysate, untreated Lane 3: Mouse liver lysate, treated with AP||AAA29768_WB.jpg
⇄⧉products_description => string (895) "Glycogen [starch] synthase belongs to the mammalian/fungal glycogen synthase...
$value[5]['_source']['products_description']
Glycogen [starch] synthase belongs to the mammalian/fungal glycogen synthase family of proteins. Two forms of this protein exist, a liver form and a muscle form, both of which have the same function in the glycogen biosynthesis pathway. Glycogen synthase transfers the glycosyl residue from UDP-Glucose to the nonreducing end of -1, 4-glucan. The liver glycogen synthase protein is truncated by 34 amino acids compared to the muscle form. However, these enzymes differ significantly in their amino- and carboxyl-terminal regions. Muscle glycogen synthase serves to fuel muscular activity only and is regulated by muscle contraction and by catecholamines. Liver glycogen synthase mediates blood glucose homeostasis in response to nutritional cues. Defects in the gene encoding liver glycogen synthase results in glycogen storage disease type 0 (GSD0), a rare form of fasting ketotic hypoglycemia.
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of h...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human RIPK3. No significant cross-reactivity or interference between human RIPK3 and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[6]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[6]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
Human Receptor-interacting serine/threonine-protein kinase 3 (RIPK3) ELISA kit; RIP3; RIP-like protein kinase 3; receptor interacting protein 3; receptor-interacting serine-threonine kinase 3
⇄products_gene_name => string (5) "RIPK3"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[6]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[6]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for RIPK3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any RIPK3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for RIPK3 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of RIPK3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Cytosolic DNA-sensing Pathway||125137!!Cytosolic DNA-sensing Pathway||124833!!Cytosolic Sensors Of Pathogen-associated DNA Pathway||576255!!DAI Mediated Induction Of Type I IFNs Pathway||576256!!Immune System Pathway||106386!!Innate Immune System Pathway||106387!!RIP-mediated NFkB Activation Via DAI Pathway||576258!!TNF-alpha/NF-kB Signaling Pathway||198884!!TRIF Mediated TLR3 Signaling Pathway||477127!!Toll Like Receptor 3 (TLR3) Cascade Pathway||106391
⇄⧉search_terms => string (570) "aaa18222 human this assay has high sensitivity and excellent specificity for...
$value[6]['_source']['search_terms']
aaa18222 human this assay has high sensitivity and excellent specificity for detection of ripk3 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa18222_td elisa kit receptor interacting serine threonine kinase 3 protein rip3 rip like 56,887 da ripk3_human 40254844 np_006862.2 q9y572 nm_006871.3 q5j795 q5j796 q6p5y1 b4djl9 c4am87 605817 samples serum plasma tissue homogenates cell lysates type quantitative sandwich range 15.6 pg ml 1000 < 3.9 intra precision within an cv kinase3 <3.9
⇄⧉specificity => string (373) "This assay has high sensitivity and excellent specificity for detection of G...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of GLY. No significant cross-reactivity or interference between GLY and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between GLY and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1376) "Principle of the Assay: GLY ELISA kit applies the competitive enzyme immunoa...
$value[7]['_source']['products_description']
Principle of the Assay: GLY ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-GLY antibody and an GLY-HRP conjugate. The assay sample and buffer are incubated together with GLY-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the GLY concentration since GLY from samples and GLY-HRP conjugate compete for the anti-GLY antibody binding site. Since the number of sites is limited, as more sites are occupied by GLY from the sample, fewer sites are left to bind GLY-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The GLY concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This GLY ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse GLY. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (567) "aaa16666 mouse this assay has high sensitivity and excellent specificity for...
$value[7]['_source']['search_terms']
aaa16666 mouse this assay has high sensitivity and excellent specificity for detection of gly no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16666_sc elisa kit glycogen partial 15,415 da s4pv39_9neop 509170463 jaa83352.1 samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 ?g ml competitive1.0
⇄⧉specificity => string (373) "This assay has high sensitivity and excellent specificity for detection of G...
$value[8]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of GLY. No significant cross-reactivity or interference between GLY and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between GLY and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[8]['_source']['purity']
⇄form => string (3) "N/A"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1370) "Intended Uses: This GLY ELISA kit is a 1.5 hour solid-phase ELISA designed f...
$value[8]['_source']['products_description']
Intended Uses: This GLY ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human GLY. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: GLY ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-GLY antibody and an GLY-HRP conjugate. The assay sample and buffer are incubated together with GLY-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the GLY concentration since GLY from samples and GLY-HRP conjugate compete for the anti-GLY antibody binding site. Since the number of sites is limited, as more sites are occupied by GLY from the sample, fewer sites are left to bind GLY-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The GLY concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (567) "aaa16478 human this assay has high sensitivity and excellent specificity for...
$value[8]['_source']['search_terms']
aaa16478 human this assay has high sensitivity and excellent specificity for detection of gly no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16478_sc elisa kit glycogen partial 15,415 da s4pv39_9neop 509170463 jaa83352.1 samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 1.0 pg ml competitive1.0
⇄⧉specificity => string (373) "This assay has high sensitivity and excellent specificity for detection of G...
$value[9]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of GLY. No significant cross-reactivity or interference between GLY and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between GLY and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[9]['_source']['purity']
⇄form => string (3) "N/A"
$value[9]['_source']['form']
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1374) "Principle of the Assay: GLY ELISA kit applies the competitive enzyme immunoa...
$value[9]['_source']['products_description']
Principle of the Assay: GLY ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-GLY antibody and an GLY-HRP conjugate. The assay sample and buffer are incubated together with GLY-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the GLY concentration since GLY from samples and GLY-HRP conjugate compete for the anti-GLY antibody binding site. Since the number of sites is limited, as more sites are occupied by GLY from the sample, fewer sites are left to bind GLY-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The GLY concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This GLY ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rat GLY. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (565) "aaa16471 rat this assay has high sensitivity and excellent specificity for d...
$value[9]['_source']['search_terms']
aaa16471 rat this assay has high sensitivity and excellent specificity for detection of gly no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16471_sc elisa kit glycogen partial 15,415 da s4pv39_9neop 509170463 jaa83352.1 samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 0.1 ?g ml competitive0.1
ICC (Immunocytochemistry)||ICC staining Phospho-GSK3 beta (Ser 9) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29773_ICC8.jpg!!ICC (Immunocytochemistry)||ICC staining Phospho-GSK3 beta (Ser 9) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.||AAA29773_ICC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-Phospho-GSK3 beta (Ser 9) antibody. Counter stained with hematoxylin.||AAA29773_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human kidney tissue using anti-Phospho-GSK3 beta (Ser 9) antibody. Counter stained with hematoxylin.||AAA29773_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-GSK3 beta (Ser 9) antibody. Counter stained with hematoxylin.||AAA29773_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human breast tissue using anti-Phospho-GSK3 beta (Ser 9) antibody. Counter stained with hematoxylin.||AAA29773_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human colon cancer tissue using anti-Phospho-GSK3 beta (Ser 9) antibody. Counter stained with hematoxylin.||AAA29773_IHC2.jpg!!WB (Western Blot)||Western blot analysis of Phospho-GSK3 beta (Ser 9) on different lysates using anti-Phospho-GSK3 beta (Ser 9) antibody at 1/1, 000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7||AAA29773_WB.jpg
⇄⧉products_description => string (1368) "Glycogen synthase kinase-3alpha (GSK-3alpha) and GSK-3beta are highly simila...
$value[10]['_source']['products_description']
Glycogen synthase kinase-3alpha (GSK-3alpha) and GSK-3beta are highly similar isoforms of serine/ threonine kinases that regulate metabolic enzymes and transcription factors, which are responsible for coordinating processes such as glycogen synthesis and cell adhesion. GSK-3beta activity is also required for nuclear activity of Rel dimers, which mediate an anti-apoptotic response to TNFalpha in mice. GSK-3 catalytic kinase activity is controlled through differential phosphorylation of serine/threonine residues, which have an inhibitory effect, and tyrosine residues, which have an activating effect. Growth factor stimulation of mammalian cells expressing GSK-3alpha and GSK-3beta induces phosphorylation of Ser 21 and Ser 9, respectively, through a phosphatidylinositol 3-kinase (PI 3-K)-protein kinase B (PKB)-dependent pathway, thereby enhancing proliferative signals. Additionally, GSK-3 physically associates with cAMP-dependent protein kinase A (PKA), which phosphorylates Ser 21 of GSK-3alpha or Ser 9 of GSK-3beta and inactivates both forms. GSK-3alpha/beta is positively regulated by phosphorylation on Tyr 279 and Tyr 216, respectively. Activated GSK-3alpha/beta participates in energy metabolism, neuronal cell development, and body pattern formation. Tyrosine dephosphorylation of GSK-3 is involved in its extracellular signal-dependent inactivation.
⇄products_references => string (3) "N/A"
$value[10]['_source']['products_references']
⇄⧉products_related_diseases => string (227) "Brain Diseases||19!!Nervous System Diseases||19!!Neoplasms||18!!Bipolar Diso...
⇄⧉search_terms => string (1095) "aaa29773 rabbit human mouse rat monoclonal sy02 71 proa affinity purified 1*...
$value[10]['_source']['search_terms']
aaa29773 rabbit human mouse rat monoclonal sy02 71 proa affinity purified 1*tbs ph7.4 1 bsa 40 glycerol preservative 0.05 sodium azide western blot wb immunocytochemistry icc immunofluorescence if immunohistochemistry ihc flow cytometry fc facs 1:1000 1:2000 1:50 1:200 analysis of phospho gsk3 beta ser 9 on different lysates using anti antibody at 000 dilution positive control lane hela 2 mcf 7 aaa29773_wb immunohistochemical paraffin embedded colon cancer tissue counter stained with hematoxylin aaa29773_ihc2 breast aaa29773_ihc3 carcinoma aaa29773_ihc4 kidney aaa29773_ihc5 pancreas aaa29773_ihc6 staining in cells green the nuclear stain is dapi blue were fixed paraformaldehyde permeabilised 0.25 triton x100 pbs aaa29773_icc7 aaa29773_icc8 glycogen synthase kinase 3 gsk gsk3b gsk3b_human gsk3beta isoform serine threonine protein 46,744 da 225903437 np_001139628.1 p49841 nm_001146156.1 q9bwh3 q9ul47 d3dn89 605004 specific ab type recombinant immunogen synthetic peptide corresponding to residues surrounding ser9 conjugation unconjugated sy0271 ph7.41 bsa40 at000 hela2 mcf7 kinase3
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of G...
$value[11]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of GPBB. No significant cross-reactivity or interference between GPBB and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between GPBB and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉etc_term1 => string (157) "Samples||Serum, plasma, cell culture supernatants, body fluid and tissue hom...
$value[11]['_source']['etc_term1']
Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Assay Type||Quantitative Competitive or Sandwich!!Sensitivity||0.1 ng/mL
⇄⧉products_description => string (1497) "Intended Uses: This GPBB ELISA kit is a 1.5 hour solid-phase ELISA designed ...
$value[11]['_source']['products_description']
Intended Uses: This GPBB ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human GPBB. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: GPBB ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for GPBB. Standards or samples are then added to the microtiter plate wells and GPBB if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of GPBB present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for GPBB are added to each well to "sandwich" the GPBB immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain GPBB and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The GPBB concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (649) "aaa16538 human this assay has high sensitivity and excellent specificity for...
$value[11]['_source']['search_terms']
aaa16538 human this assay has high sensitivity and excellent specificity for detection of gpbb no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16538_sc elisa kit glycogen phosphorylase lsoenzyme bb brain form pygb b 96,696 da pygb_human 21361370 np_002853.2 p11216 nm_002862.3 q96ak1 q9npx8 138550 samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive sandwich 0.1 ng ml sandwich0.1
Phospho-GSK3 beta (Thr390) Antibody detects endogenous levels of GSK3 beta only when phosphorylated at Thr390.<br>Tissue Specificity: Expressed in testis, thymus, prostate and ovary and weakly expressed in lung, brain and kidney. Colocalizes with EIF2AK2/PKR and TAU in the Alzheimer disease (AD) brain.
⇄⧉purity => string (158) "The antibody is from purified rabbit serum by affinity purification via sequ...
$value[12]['_source']['purity']
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
⇄⧉testing_protocols => string (4292) "Application Data||At 25 degree C. Samples were then incubated with primary A...
$value[12]['_source']['testing_protocols']
Application Data||At 25 degree C. Samples were then incubated with primary Ab(At 37 degree C. An AlexaFluor594 conjugated goat anti-rabbit IgG(H+L) Ab(Red) and an AlexaFluor488 conjugated goat anti-mouse IgG(H+L) Ab(Green) were used as the secondary antibody.<br>The nuclear counter stain is DAPI (blue).||AAA31297_APP12.jpg!!IHC (Immunohistochemistry)||At 1/100 staining Human kidney cancer and adjacent normal tissues by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC11.jpg!!IHC (Immunohistochemistry)||At 1/100 staining Human kidney cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC10.jpg!!IHC (Immunohistchemistry)||At 1/100 staining Mouse kidney tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC9.jpg!!IHC (Immunohistochemistry)||At 1/100 staining Mouse brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC8.jpg!!IHC (Immunohistochemistry)||At 1/100 staining Mouse colorectal tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC7.jpg!!IHC (Immunohistchemistry)||At 1/100 staining Mouse muscle tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC6.jpg!!IHC (Immunohistochemistry)||At 1/100 staining Rat heart tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC5.jpg!!IHC (Immunohistochemistry)||At 1/100 staining Rat liver tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC4.jpg!!IHC (Immunohistochemistry)||At 1/100 staining Rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC3.jpg!!IHC (Immunohistochemistry)||Staining Rat stomach tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Rabbit antibody was used as the secondary antibody.||AAA31297_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts from HeLa cells, cells treated with hydroxyurea, using Phospho-GSK3B (Thr390) Antibody . The lane on the left was treated with blocking peptide.||AAA31297_WB.jpg
⇄⧉etc_term1 => string (155) "Immunogen||A synthesized peptide derived from human GSK3 beta around the pho...
$value[12]['_source']['etc_term1']
Immunogen||A synthesized peptide derived from human GSK3 beta around the phosphorylation site of Thr390.!!Conjugation||Unconjugated!!Fragment||Fab fragment
⇄⧉etc_term2 => string (2090) "Post Translational Modifications||Phosphorylated by AKT1 and ILK1. Upon insu...
$value[12]['_source']['etc_term2']
Post Translational Modifications||Phosphorylated by AKT1 and ILK1. Upon insulin-mediated signaling, the activated PKB/AKT1 protein kinase phosphorylates and desactivates GSK3B, resulting in the dephosphorylation and activation of GYS1. Activated by phosphorylation at Tyr-216. Inactivated by phosphorylation at Ser-9 (Probable). Phosphorylated in a circadian manner in the hippocampus (By similarity).Mono-ADP-ribosylation by PARP10 negatively regulates kinase activity.!!Subunit Structure||Monomer. Interacts with ARRB2, DISC1 and ZBED3 (By similarity). Interacts with CABYR, MMP2, MUC1, NIN and PRUNE1. Interacts with AXIN1; the interaction mediates hyperphosphorylation of CTNNB1 leading to its ubiquitination and destruction. Interacts with and phosphorylates SNAI1. Interacts with DNM1L (via a C-terminal domain). Found in a complex composed of MACF1, APC, AXIN1, CTNNB1 and GSK3B (By similarity). Interacts with SGK3. Interacts with DAB2IP (via C2 domain); the interaction stimulates GSK3B kinase activation. Interacts (via C2 domain) with PPP2CA. Interacts with the CLOCK-ARNTL/BMAL1 heterodimer. Interacts with the ARNTL/BMAL1. Interacts with CTNND2. Interacts with NCYM. The complex composed, at least, of APC, CTNNB1 and GSK3B interacts with JPT1; the interaction requires the inactive form of GSK3B (phosphorylated at 'Ser-9'). Forms a complex composed of PRKAR2A or PRKAR2B, GSK3B and GSKIP through GSKIP interaction; facilitates PKA-induced phosphorylation and regulates GSK3B activity. Interacts with GSKIP. Interacts with GID8. Interacts with PIWIL2 (By similarity). Interacts with LMBR1L. Interacts with DDX3X. Interacts with BIRC2. Interacts with TNFRSF10B; TNFRSF10B stimulation inhibits GSK3B kinase activity.!!Similarity||Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. GSK-3 subfamily.!!Subcellular Location||Cytoplasm. Nucleus. Cell membrane.<br>Note: The phosphorylated form shows localization to cytoplasm and cell membrane. The MEMO1-RHOA-DIAPH1 signaling pathway controls localization of the phosphorylated form to the cell membrane.
⇄⧉products_description => string (3954) "Constitutively active protein kinase that acts as a negative regulator in th...
$value[12]['_source']['products_description']
Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), EIF2B, CTNNB1/beta-catenin, APC, AXIN1, DPYSL2/CRMP2, JUN, NFATC1/NFATC, MAPT/TAU and MACF1. Requires primed phosphorylation of the majority of its substrates. In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. May also mediate the development of insulin resistance by regulating activation of transcription factors. Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase. In Wnt signaling, GSK3B forms a multimeric complex with APC, AXIN1 and CTNNB1/beta-catenin and phosphorylates the N-terminus of CTNNB1 leading to its degradation mediated by ubiquitin/proteasomes. Phosphorylates JUN at sites proximal to its DNA-binding domain, thereby reducing its affinity for DNA. Phosphorylates NFATC1/NFATC on conserved serine residues promoting NFATC1/NFATC nuclear export, shutting off NFATC1/NFATC gene regulation, and thereby opposing the action of calcineurin. Phosphorylates MAPT/TAU on 'Thr-548', decreasing significantly MAPT/TAU ability to bind and stabilize microtubules. MAPT/TAU is the principal component of neurofibrillary tangles in Alzheimer disease. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Phosphorylates MACF1, inhibiting its binding to microtubules which is critical for its role in bulge stem cell migration and skin wound repair. Probably regulates NF-kappa-B (NFKB1) at the transcriptional level and is required for the NF-kappa-B-mediated anti-apoptotic response to TNF-alpha (TNF/TNFA). Negatively regulates replication in pancreatic beta-cells, resulting in apoptosis, loss of beta-cells and diabetes. Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation. Phosphorylates MUC1 in breast cancer cells, decreasing the interaction of MUC1 with CTNNB1/beta-catenin. Is necessary for the establishment of neuronal polarity and axon outgrowth. Phosphorylates MARK2, leading to inhibit its activity. Phosphorylates SIK1 at 'Thr-182', leading to sustain its activity. Phosphorylates ZC3HAV1 which enhances its antiviral activity. Phosphorylates SNAI1, leading to its BTRC-triggered ubiquitination and proteasomal degradation. Phosphorylates SFPQ at 'Thr-687' upon T-cell activation. Phosphorylates NR1D1 st 'Ser-55' and 'Ser-59' and stabilizes it by protecting it from proteasomal degradation. Regulates the circadian clock via phosphorylation of the major clock components including ARNTL/BMAL1, CLOCK and PER2. Phosphorylates CLOCK AT 'Ser-427' and targets it for proteasomal degradation. Phosphorylates ARNTL/BMAL1 at 'Ser-17' and 'Ser-21' and primes it for ubiquitination and proteasomal degradation. Phosphorylates OGT at 'Ser-3' or 'Ser-4' which positively regulates its activity. Phosphorylates MYCN in neuroblastoma cells which may promote its degradation. Regulates the circadian rhythmicity of hippocampal long-term potentiation and ARNTL/BMLA1 and PER2 expression (By similarity). Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions, leading to activate KAT5/TIP60 acetyltransferase activity and promote acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer. Negatively regulates extrinsic apoptotic signaling pathway via death domain receptors. Promotes the formation of an anti-apoptotic complex, made of DDX3X, BRIC2 and GSK3B, at death receptors, including TNFRSF10B. The anti-apoptotic function is most effective with weak apoptotic signals and can be overcome by stronger stimulation.
⇄products_references => string (3) "N/A"
$value[12]['_source']['products_references']
⇄⧉products_related_diseases => string (227) "Brain Diseases||19!!Nervous System Diseases||19!!Neoplasms||18!!Bipolar Diso...
⇄⧉products_description => string (1341) "Intended Uses||This PI3K ELISA kit is a 1.5 hour solid-phase ELISA designed ...
$value[13]['_source']['products_description']
Intended Uses||This PI3K ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse PI3K. This ELISA kit for research use only!<br><br>Principle of the Assay: PI3K ELISA kit applies the competitive enzyme immunoassay technique utilizing a monoclonal anti-PI3K antibody and an PI3K-HRP conjugate. The assay sample and buffer are incubated together with PI3K-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the PI3K concentration since PI3K from samples and PI3K-HRP conjugate compete for the anti-PI3K antibody binding site. Since the number of sites is limited, as more sites are occupied by PI3K from the sample, fewer sites are left to bind PI3K-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The PI3K concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (288) "aaa17274 mouse typical testing data standard curve for reference only aaa172...
$value[13]['_source']['search_terms']
aaa17274 mouse typical testing data standard curve for reference only aaa17274_td elisa kit phosphatidylinositol 3 kinase pi3k samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive sensitivity 0.1 ng ml phosphatidylinositol3 sensitivity0.1
⇄⧉products_description => string (826) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[14]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse PI3K monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (606) "aaa12623 mouse no cross reaction with other factors typical testing data sta...
$value[14]['_source']['search_terms']
aaa12623 mouse no cross reaction with other factors typical testing data standard curve for reference only aaa12623_sc elisa kit phosphotylinosital 3 kinase pi3k phosphatidylinositol 4,5 bisphosphate catalytic subunit beta isoform 1 pik3cb pik3c1 p110beta pi3kbeta ptdins p110 pi3 phosphoinositide polypeptide 110 kda 122,762 da pk3cb_human 5453894 np_006210.1 p42338 nm_006219.2 q24ju2 d3dnf0 602925 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156ng sensitivity up to 0.05 intra precision phosphotylinosital3 isoform1 polypeptide110 range10
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of M...
$value[15]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of MTR. No significant cross-reactivity or interference between MTR and analogues was observed.
⇄purity => string (3) "N/A"
$value[15]['_source']['purity']
⇄form => string (3) "N/A"
$value[15]['_source']['form']
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[15]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[15]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (238) "Nervous System Diseases||506!!Demyelinating Diseases||261!!Brain Diseases||2...
Biological Oxidations Pathway||1270189!!Biosynthesis Of Amino Acids Pathway||790012!!Biosynthesis Of Amino Acids Pathway||795174!!Cobalamin (Cbl, Vitamin B12) Transport And Metabolism Pathway||1270152!!Cysteine And Methionine Metabolism Pathway||104488!!Cysteine And Methionine Metabolism Pathway||103421!!Defective MTR Causes Methylmalonic Aciduria And Homocystinuria Type CblG Pathway||1268969!!Defective MTRR Causes Methylmalonic Aciduria And Homocystinuria Type CblE Pathway||1268968!!Defects In Cobalamin (B12) Metabolism Pathway||1268960!!Defects In Vitamin And Cofactor Metabolism Pathway||1268959
⇄⧉search_terms => string (599) "aaa17567 human this assay has high sensitivity and excellent specificity for...
$value[15]['_source']['search_terms']
aaa17567 human this assay has high sensitivity and excellent specificity for detection of mtr no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17567_sc elisa kit methionine synthase 5 methyltetrahydrofolate homocysteine methyltransferase vitamin b12 dependent ms hmag cblg 134,793 da meth_human 2842762 q99707.2 q99707 q99713 q99723 a1l4n8 a9z1w4 b7zlw7 b9egf7 156570 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 0.625 40ng ml 0.375ng intra precision cv synthase5
⇄⧉products_description => string (823) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[16]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat NOS monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (533) "aaa12519 rat typical testing data standard curve for reference only aaa12519...
$value[16]['_source']['search_terms']
aaa12519 rat typical testing data standard curve for reference only aaa12519_sc elisa kit nitric oxide synthase nos partial 3 endothelial cell nos3 enos ecnos cnos ec nosiii type iii constitutive transcript variant delta20 delta21 21 67,876 da nos3_human 4262036 aad14336.1 p29474 q13662 q14251 q14434 q548c1 q6gsl5 q9udc6 a0s0a7 a0s0a8 a8ka63 b2rcq1 e9pfr2 163729 samples serum plasma or culture supernatant assay quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision partial3 delta2121 range20
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of h...
$value[17]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human PI3K. No significant cross-reactivity or interference between human PI3K and analogues was observed.
⇄purity => string (3) "N/A"
$value[17]['_source']['purity']
⇄form => string (3) "N/A"
$value[17]['_source']['form']
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[17]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[17]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[17]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for PI3K has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any PI3K present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for PI3K is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of PI3K bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (526) "aaa15516 human this assay has high sensitivity and excellent specificity for...
$value[17]['_source']['search_terms']
aaa15516 human this assay has high sensitivity and excellent specificity for detection of pi3k no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15516_td elisa kit phosphotylinosital 3 kinase samples serum tissue homogenates cell lysates type quantitative sandwich range 0.625 ng ml 40 <0.156 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in phosphotylinosital3 ml40
⇄⧉products_description => string (824) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[18]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat PI3K monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (602) "aaa12420 rat no cross reaction with other factors typical testing data stand...
$value[18]['_source']['search_terms']
aaa12420 rat no cross reaction with other factors typical testing data standard curve for reference only aaa12420_sc elisa kit phosphotylinosital 3 kinase pi3k phosphatidylinositol 4,5 bisphosphate catalytic subunit beta isoform 1 pik3cb pik3c1 p110beta pi3kbeta ptdins p110 pi3 phosphoinositide polypeptide 110 kda 122,762 da pk3cb_human 5453894 np_006210.1 p42338 nm_006219.2 q24ju2 d3dnf0 602925 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision phosphotylinosital3 isoform1 polypeptide110 range20
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[19]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human NOS monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (572) "aaa12693 human no cross reaction with other factors typical testing data sta...
$value[19]['_source']['search_terms']
aaa12693 human no cross reaction with other factors typical testing data standard curve for reference only aaa12693_sc elisa kit nitric oxide synthase nos partial 3 endothelial cell nos3 enos ecnos cnos ec nosiii type iii constitutive transcript variant delta20 delta21 21 67,876 da nos3_human 4262036 aad14336.1 p29474 q13662 q14251 q14434 q548c1 q6gsl5 q9udc6 a0s0a7 a0s0a8 a8ka63 b2rcq1 e9pfr2 163729 samples serum plasma or culture supernatant assay quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision partial3 delta2121 range20
