Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AZU1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Rabbit AZU1 Polyclonal Antibody | anti-AZU1 antibody

AZU1 Antibody - middle region

Gene Names
AZU1; AZU; HBP; NAZC; hHBP; AZAMP; CAP37; HUMAZUR
Reactivity
Cow, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AZU1; Polyclonal Antibody; AZU1 Antibody - middle region; anti-AZU1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLL
Sequence Length
226
Applicable Applications for anti-AZU1 antibody
Western Blot (WB)
Homology
Cow: 100%; Horse: 75%; Human: 100%; Pig: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AZU1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AZU1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AZU1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-AZU1 antibody
This is a rabbit polyclonal antibody against AZU1. It was validated on Western Blot

Target Description: Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. This gene encodes a preproprotein that is proteolytically processed to generate a mature azurophil granule antibiotic protein, with monocyte chemotactic and antimicrobial activity. It is also an important multifunctional inflammatory mediator. This encoded protein is a member of the serine protease gene family but it is not a serine proteinase, because the active site serine and histidine residues are replaced. The genes encoding this protein, neutrophil elastase 2, and proteinase 3 are in a cluster located at chromosome 19pter. All 3 genes are expressed coordinately and their protein products are packaged together into azurophil granules during neutrophil differentiation.
Product Categories/Family for anti-AZU1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
566
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
azurocidin preproprotein
NCBI Official Synonym Full Names
azurocidin 1
NCBI Official Symbol
AZU1
NCBI Official Synonym Symbols
AZU; HBP; NAZC; hHBP; AZAMP; CAP37; HUMAZUR
NCBI Protein Information
azurocidin
UniProt Protein Name
Azurocidin
Protein Family
UniProt Gene Name
AZU1
UniProt Synonym Gene Names
HBP
UniProt Entry Name
CAP7_HUMAN

NCBI Description

Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. This gene encodes a preproprotein that is proteolytically processed to generate a mature azurophil granule antibiotic protein, with monocyte chemotactic and antimicrobial activity. It is also an important multifunctional inflammatory mediator. This encoded protein is a member of the serine protease gene family but it is not a serine proteinase, because the active site serine and histidine residues are replaced. The genes encoding this protein, neutrophil elastase 2, and proteinase 3 are in a cluster located at chromosome 19pter. All 3 genes are expressed coordinately and their protein products are packaged together into azurophil granules during neutrophil differentiation. [provided by RefSeq, Nov 2015]

Uniprot Description

AZU1: This is a neutrophil granule-derived antibacterial and monocyte- and fibroblast-specific chemotactic glycoprotein. Binds heparin. The cytotoxic action is limited to many species of Gram- negative bacteria; this specificity may be explained by a strong affinity of the very basic N-terminal half for the negatively charged lipopolysaccharides that are unique to the Gram-negative bacterial outer envelope. It may play a role in mediating recruitment of monocytes in the second wave of inflammation. Has antibacterial activity against the Gram-nagative bacterium P.aeruginosa, this activity is inhibited by LPS from P.aeruginosa. Acting alone, it does not have antimicrobial activity against the Gram-negative bacteria A.actinomycetemcomitans ATCC 29532, A.actinomycetemcomitans NCTC 9709, A.actinomycetemcomitans FDC-Y4, H.aphrophilus ATCC 13252, E.corrodens ATCC 23834, C.sputigena ATCC 33123, Capnocytophaga sp ATCC 33124, Capnocytophaga sp ATCC 27872 or E.coli ML-35. Has antibacterial activity against C.sputigena ATCC 33123 when acting synergistically with either elastase or cathepsin G. Belongs to the peptidase S1 family. Elastase subfamily.

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: azurophil granule; extracellular region

Molecular Function: heparin binding; toxin binding; serine-type endopeptidase activity

Biological Process: positive regulation of tumor necrosis factor biosynthetic process; positive regulation of cell adhesion; microglial cell activation; glial cell migration; proteolysis; defense response to Gram-negative bacterium; macrophage chemotaxis; induction of positive chemotaxis; cellular extravasation; monocyte activation; positive regulation of MHC class II biosynthetic process; positive regulation of phagocytosis; protein kinase C activation; positive regulation of fractalkine biosynthetic process; positive regulation of interleukin-1 beta biosynthetic process; immune response; protein processing; regulation of vascular permeability; inflammatory response; negative regulation of apoptosis

Research Articles on AZU1

Similar Products

Product Notes

The AZU1 azu1 (Catalog #AAA3219276) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AZU1 Antibody - middle region reacts with Cow, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's AZU1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AZU1 azu1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSQNPGVSTV VLGAYDLRRR ERQSRQTFSI SSMSENGYDP QQNLNDLMLL. It is sometimes possible for the material contained within the vial of "AZU1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.