Western Blot (WB)
(WB Suggested Anti-AURKC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Pancreas)
Rabbit AURKC Polyclonal Antibody | anti-AURKC antibody
AURKC antibody - middle region
Gene Names
AURKC; AIE2; AIK3; ARK3; AurC; SPGF5; STK13; HEL-S-90; aurora-C
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AURKC; Polyclonal Antibody; AURKC antibody - middle region; anti-AURKC antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL
Sequence Length
309
Applicable Applications for anti-AURKC antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AURKC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-AURKC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Pancreas)
Western Blot (WB)
(WB Suggested Anti-AURKC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Pancreas)
Related Product Information for anti-AURKC antibody
This is a rabbit polyclonal antibody against AURKC. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.
Target Description: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-AURKC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
aurora kinase C isoform 1
NCBI Official Synonym Full Names
aurora kinase C
NCBI Official Symbol
AURKC
NCBI Official Synonym Symbols
AIE2; AIK3; ARK3; AurC; SPGF5; STK13; HEL-S-90; aurora-C
NCBI Protein Information
aurora kinase C
UniProt Protein Name
Aurora kinase C
Protein Family
UniProt Gene Name
AURKC
UniProt Synonym Gene Names
AIE2; AIK3; AIRK3; ARK3; STK13; ARK-3
UniProt Entry Name
AURKC_HUMAN
NCBI Description
This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Research Articles on AURKC
Similar Products
Product Notes
The AURKC aurkc (Catalog #AAA3211379) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AURKC antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AURKC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AURKC aurkc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYDEKVDLWC IGVLCYELLV GYPPFESASH SETYRRILKV DVRFPLSMPL. It is sometimes possible for the material contained within the vial of "AURKC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
