Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ATXN10 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellATXN10 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit ATXN10 Polyclonal Antibody | anti-ATXN10 antibody

ATXN10 antibody - N-terminal region

Gene Names
ATXN10; E46L; SCA10; HUMEEP
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATXN10; Polyclonal Antibody; ATXN10 antibody - N-terminal region; anti-ATXN10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKS
Sequence Length
475
Applicable Applications for anti-ATXN10 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ATXN10 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellATXN10 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-ATXN10 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellATXN10 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-ATXN10 antibody
This is a rabbit polyclonal antibody against ATXN10. It was validated on Western Blot

Target Description: This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of a pentanucleotide repeat in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-ATXN10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
ataxin-10 isoform 1
NCBI Official Synonym Full Names
ataxin 10
NCBI Official Symbol
ATXN10
NCBI Official Synonym Symbols
E46L; SCA10; HUMEEP
NCBI Protein Information
ataxin-10
UniProt Protein Name
Ataxin-10
Protein Family
UniProt Gene Name
ATXN10
UniProt Synonym Gene Names
SCA10
UniProt Entry Name
ATX10_HUMAN

NCBI Description

This gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of an ATTCT repeat from 9-32 copies to 800-4500 copies in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described.[provided by RefSeq, Jul 2016]

Uniprot Description

ataxin-10: Necessary for the survival of cerebellar neurons. Induces neuritogenesis by activating the Ras-MAP kinase pathway. May play a role in the maintenance of a critical intracellular glycosylation level and homeostasis. Defects in ATXN10 are the cause of spinocerebellar ataxia type 10 (SCA10). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA10 is an autosomal dominant cerebellar ataxia (ADCA). Defects in ATXN1 may be a cause of nephronophthisis a chronic tubulo-interstitial nephropathy taht leads to anemia, polyuria, polydipsia, isosthenuria and death in uremia. Belongs to the ataxin-10 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: extracellular space; cell soma; membrane; perinuclear region of cytoplasm; cytoplasm; dendrite; plasma membrane; cytosol

Molecular Function: identical protein binding; protein binding

Biological Process: nervous system development; neurite development

Disease: Spinocerebellar Ataxia 10

Research Articles on ATXN10

Similar Products

Product Notes

The ATXN10 atxn10 (Catalog #AAA3215388) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATXN10 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATXN10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATXN10 atxn10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PARLSGVMVP APIQDLEALR ALTALFKEQR NRETAPRTIF QRVLDILKKS. It is sometimes possible for the material contained within the vial of "ATXN10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.