Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C2orf28 polyclonal antibody. Western Blot analysis of C2orf28 expression in human kidney.)

Mouse anti-Human ATRAID Polyclonal Antibody | anti-ATRAID antibody

ATRAID (APR3, All-trans Retinoic Acid-induced Differentiation Factor, Apoptosis-related Protein 3, APR-3, p18, C2orf28, HSPC013, UNQ214/PRO240)

Gene Names
ATRAID; p18; APR3; APR-3; APR--3; PRO240; C2orf28; HSPC013
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ATRAID; Polyclonal Antibody; ATRAID (APR3; All-trans Retinoic Acid-induced Differentiation Factor; Apoptosis-related Protein 3; APR-3; p18; C2orf28; HSPC013; UNQ214/PRO240); Anti -ATRAID (APR3; anti-ATRAID antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C2orf28.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Applicable Applications for anti-ATRAID antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C2orf28, aa1-171 (NP_057169.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(C2orf28 polyclonal antibody. Western Blot analysis of C2orf28 expression in human kidney.)

Western Blot (WB) (C2orf28 polyclonal antibody. Western Blot analysis of C2orf28 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of C2orf28 expression in transfected 293T cell line by C2orf28 polyclonal antibody. Lane 1: C2orf28 transfected lysate (18.81kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C2orf28 expression in transfected 293T cell line by C2orf28 polyclonal antibody. Lane 1: C2orf28 transfected lysate (18.81kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ATRAID antibody
APR3 may play a critical role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway.
Product Categories/Family for anti-ATRAID antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,747 Da
NCBI Official Full Name
all-trans retinoic acid-induced differentiation factor isoform b
NCBI Official Synonym Full Names
all-trans retinoic acid-induced differentiation factor
NCBI Official Symbol
ATRAID
NCBI Official Synonym Symbols
p18; APR3; APR-3; APR--3; PRO240; C2orf28; HSPC013
NCBI Protein Information
all-trans retinoic acid-induced differentiation factor; apoptosis related protein 3; apoptosis-related protein 3; apoptosis related protein APR-3
UniProt Protein Name
All-trans retinoic acid-induced differentiation factor
UniProt Gene Name
ATRAID
UniProt Synonym Gene Names
APR3; C2orf28; APR-3
UniProt Entry Name
ARAID_HUMAN

NCBI Description

This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. The use of alternative splice sites and promotors result in multiple transcript variants encoding different isoforms.[provided by RefSeq, Dec 2009]

Uniprot Description

APR3: May play a critical role in inducing the cell cycle arrest via inhibiting CCND1 expression in all-trans-retinoic acid (ATRA) signal pathway. Up-regulated by all-trans-retinoic acid (ATRA) in several tumor cell lines. Weakly expressed in hematopoietic cell lines. 3 isoforms of the human protein are produced by alternative promoter.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: perinuclear region of cytoplasm; plasma membrane; integral to membrane; nuclear envelope

Molecular Function: protein binding

Biological Process: positive regulation of osteoblast differentiation; regulation of gene expression; negative regulation of osteoblast proliferation; cell differentiation; positive regulation of bone mineralization

Research Articles on ATRAID

Similar Products

Product Notes

The ATRAID atraid (Catalog #AAA6011113) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ATRAID (APR3, All-trans Retinoic Acid-induced Differentiation Factor, Apoptosis-related Protein 3, APR-3, p18, C2orf28, HSPC013, UNQ214/PRO240) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATRAID can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ATRAID atraid for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLHARCCLNQ KGTILGLDLQ NCSLEDPGPN FHQAHTTVII DLQANPLKGD LANTFRGFTQ LQTLILPQHV NCPGGINAWN TITSYIDNQI CQGQKNLCNN TGDPEMCPEN GSCVPDGPGL LQCVCADGFH GYKCMRQGSF SLLMFFGILG ATTLSVSILL WATQRRKAKT S. It is sometimes possible for the material contained within the vial of "ATRAID, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.