Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human ATP6V1C1 Polyclonal Antibody | anti-ATP6V1C1 antibody

ATP6V1C1 (V-type Proton ATPase Subunit C 1, V-ATPase Subunit C 1, Vacuolar Proton Pump Subunit C 1, ATP6C, ATP6D, VATC) (MaxLight 750)

Gene Names
ATP6V1C1; VATC; Vma5; ATP6C; ATP6D
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ATP6V1C1; Polyclonal Antibody; ATP6V1C1 (V-type Proton ATPase Subunit C 1; V-ATPase Subunit C 1; Vacuolar Proton Pump Subunit C 1; ATP6C; ATP6D; VATC) (MaxLight 750); anti-ATP6V1C1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATP6V1C1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-ATP6V1C1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ATP6V1C1, aa1-382 (NP_001686.1).
Immunogen Sequence
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ATP6V1C1 antibody
This protein is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.
Product Categories/Family for anti-ATP6V1C1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
528
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,942 Da
NCBI Official Full Name
V-type proton ATPase subunit C 1
NCBI Official Synonym Full Names
ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
NCBI Official Symbol
ATP6V1C1
NCBI Official Synonym Symbols
VATC; Vma5; ATP6C; ATP6D
NCBI Protein Information
V-type proton ATPase subunit C 1; V-ATPase C subunit; H+ -ATPase C subunit; V-ATPase subunit C 1; vacuolar proton pump C subunit; vacuolar ATP synthase subunit C; vacuolar proton pump subunit C 1; vacuolar proton pump, 42-kD subunit; H+-transporting ATPas
UniProt Protein Name
V-type proton ATPase subunit C 1
Protein Family
UniProt Gene Name
ATP6V1C1
UniProt Synonym Gene Names
ATP6C; ATP6D; VATC; V-ATPase subunit C 1
UniProt Entry Name
VATC1_HUMAN

Uniprot Description

ATP6V1C1: Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the V-ATPase C subunit family.

Protein type: Hydrolase; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation; Transporter; EC 3.6.3.14

Chromosomal Location of Human Ortholog: 8q22.3

Cellular Component: apical part of cell; lysosomal membrane; plasma membrane; cytoplasmic vesicle; proton-transporting two-sector ATPase complex; cytosol

Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism; protein binding; transporter activity; hydrogen ion transporting ATPase activity, rotational mechanism

Biological Process: interaction with host; proton transport; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; transmembrane transport

Similar Products

Product Notes

The ATP6V1C1 atp6v1c1 (Catalog #AAA6370769) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP6V1C1 (V-type Proton ATPase Subunit C 1, V-ATPase Subunit C 1, Vacuolar Proton Pump Subunit C 1, ATP6C, ATP6D, VATC) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V1C1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATP6V1C1 atp6v1c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP6V1C1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.