Rabbit anti-Human, Mouse ATP6V1A Polyclonal Antibody | anti-ATP6V1A antibody

ATP6V1A Polyclonal Antibody

Cat. Num. AAA9134698

• Gene Names: ATP6V1A; HO68; VA68; VPP2; Vma1; ARCL2D; ATP6A1; ATP6V1A1
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: ATP6V1A; Polyclonal Antibody; ATP6V1A Polyclonal Antibody; ARCL2D; ATP6A1; ATP6V1A1; HO68; VA68; Vma1; VPP2; anti-ATP6V1A antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD
• Sequence Length: 617

• Applicable Applications for anti-ATP6V1A antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: A synthetic peptide of human ATP6V1A
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Positive Samples: 293T, LO2, HeLa, Mouse brain, Mouse heart, Mouse kidney
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ATP6V1A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3min.)

Related Product Information for anti-ATP6V1A antibody

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist.

Product Categories/Family for anti-ATP6V1A antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 19913424
• NCBI GeneID: 523
• NCBI Accession #: NP_001681.2
• NCBI GenBank Nucleotide #: NM_001690.3
• UniProt Accession #: P38606; Q53YD9; Q96DY6; Q9UHY3; B2RBR8; B7Z1R5; D3DN75
• Molecular Weight: Calculated: 64kDa; 68kDa; Observed: 72kDa
• NCBI Official Full Name: V-type proton ATPase catalytic subunit A
• NCBI Official Synonym Full Names: ATPase H+ transporting V1 subunit A
• NCBI Official Symbol: ATP6V1A
• NCBI Official Synonym Symbols: HO68; VA68; VPP2; Vma1; ARCL2D; ATP6A1; ATP6V1A1
• NCBI Protein Information: V-type proton ATPase catalytic subunit A
• UniProt Protein Name: V-type proton ATPase catalytic subunit A
• UniProt Gene Name: ATP6V1A
• UniProt Synonym Gene Names: ATP6A1; ATP6V1A1; VPP2; V-ATPase subunit A

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. [provided by RefSeq, Jul 2008]

Uniprot Description

Catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe2+ prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (PubMed:28296633).