Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATP6V0CSample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

Rabbit ATP6V0C Polyclonal Antibody | anti-ATP6V0C antibody

ATP6V0C antibody - middle region

Gene Names
ATP6V0C; ATPL; VATL; VPPC; Vma3; ATP6C; ATP6L
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATP6V0C; Polyclonal Antibody; ATP6V0C antibody - middle region; anti-ATP6V0C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
Sequence Length
155
Applicable Applications for anti-ATP6V0C antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Pig: 79%; Rabbit: 86%; Rat: 90%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATP6V0CSample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATP6V0CSample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ATP6V0CSample Type: ACHNAntibody Dilution: 1.0ug/mlATP6V0C is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

Western Blot (WB) (Host: RabbitTarget Name: ATP6V0CSample Type: ACHNAntibody Dilution: 1.0ug/mlATP6V0C is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

Western Blot (WB)

(Host: RabbitTarget Name: ATP6V0CSample Type: Human LungAntibody Dilution: 1.0 ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATP6V0CSample Type: Human LungAntibody Dilution: 1.0 ug/ml)

Western Blot (WB)

(WB Suggested Anti-ATP6V0C Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate.ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-ATP6V0C Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate.ATP6V0C is strongly supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-ATP6V0C antibody
This is a rabbit polyclonal antibody against ATP6V0C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is part of the V0 domain. This gene had the previous symbols of ATP6C and ATP6L.
Product Categories/Family for anti-ATP6V0C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
527
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
V-type proton ATPase 16 kDa proteolipid subunit
NCBI Official Synonym Full Names
ATPase H+ transporting V0 subunit c
NCBI Official Symbol
ATP6V0C
NCBI Official Synonym Symbols
ATPL; VATL; VPPC; Vma3; ATP6C; ATP6L
NCBI Protein Information
V-type proton ATPase 16 kDa proteolipid subunit
UniProt Protein Name
V-type proton ATPase 16 kDa proteolipid subunit
UniProt Gene Name
ATP6V0C
UniProt Synonym Gene Names
ATP6C; ATP6L; ATPL; V-ATPase 16 kDa proteolipid subunit
UniProt Entry Name
VATL_HUMAN

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. [provided by RefSeq, Nov 2010]

Uniprot Description

ATP6V0C: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Belongs to the V-ATPase proteolipid subunit family.

Protein type: Transporter, iron; Transporter, ion channel; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: phagocytic vesicle membrane; focal adhesion; lysosomal membrane; integral to membrane; endosome membrane

Molecular Function: protein binding; ubiquitin protein ligase binding; hydrogen ion transporting ATP synthase activity, rotational mechanism; hydrogen ion transporting ATPase activity, rotational mechanism

Biological Process: interaction with host; proton transport; viral reproduction; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; transmembrane transport; positive regulation of Wnt receptor signaling pathway

Research Articles on ATP6V0C

Similar Products

Product Notes

The ATP6V0C atp6v0c (Catalog #AAA3207668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP6V0C antibody - middle region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V0C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP6V0C atp6v0c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVAVLIANSL NDDISLYKSF LQLGAGLSVG LSGLAAGFAI GIVGDAGVRG. It is sometimes possible for the material contained within the vial of "ATP6V0C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.