Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ATPO antibody Titration: 1 ug/mLSample Type: Human Ovary Tumor)

Rabbit anti-Human ATP5PO Polyclonal Antibody | anti-ATP5PO antibody

ATP5PO Antibody - N-terminal region

Gene Names
ATP5PO; ATPO; OSCP; ATP5O; HMC08D05
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATP5PO; Polyclonal Antibody; ATP5PO Antibody - N-terminal region; anti-ATP5PO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITA
Sequence Length
213
Applicable Applications for anti-ATP5PO antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-ATP5O antibody is: synthetic peptide directed towards the N-terminal region of Human ATPO
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ATPO antibody Titration: 1 ug/mLSample Type: Human Ovary Tumor)

Western Blot (WB) (WB Suggested Anti-ATPO antibody Titration: 1 ug/mLSample Type: Human Ovary Tumor)
Related Product Information for anti-ATP5PO antibody
This is a rabbit polyclonal antibody against ATPO. It was validated on Western Blot

Target Description: The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance.
Product Categories/Family for anti-ATP5PO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
539
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa
NCBI Official Full Name
ATP synthase subunit O, mitochondrial
NCBI Official Synonym Full Names
ATP synthase peripheral stalk subunit OSCP
NCBI Official Symbol
ATP5PO
NCBI Official Synonym Symbols
ATPO; OSCP; ATP5O; HMC08D05
NCBI Protein Information
ATP synthase subunit O, mitochondrial
UniProt Protein Name
ATP synthase subunit O, mitochondrial
UniProt Gene Name
ATP5O
UniProt Synonym Gene Names
ATPO; OSCP
UniProt Entry Name
ATPO_HUMAN

NCBI Description

The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP5O: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Belongs to the ATPase delta chain family.

Protein type: Mitochondrial; Energy Metabolism - oxidative phosphorylation; EC 3.6.3.14; Hydrolase

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: mitochondrion; mitochondrial inner membrane; plasma membrane; nucleus; mitochondrial proton-transporting ATP synthase complex

Molecular Function: transporter activity; ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; drug binding; transmembrane transporter activity

Biological Process: cellular metabolic process; proton transport; ATP biosynthetic process; mitochondrial ATP synthesis coupled proton transport

Research Articles on ATP5PO

Similar Products

Product Notes

The ATP5PO atp5o (Catalog #AAA3219667) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP5PO Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5PO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP5PO atp5o for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AASKQNKLEQ VEKELLRVAQ ILKEPKVAAS VLNPYVKRSI KVKSLNDITA. It is sometimes possible for the material contained within the vial of "ATP5PO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.