Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATP5DSample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ATP5F1D Polyclonal Antibody | anti-ATP5F1D antibody

ATP5F1D Antibody - middle region

Gene Names
ATP5F1D; ATP5D; MC5DN5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATP5F1D; Polyclonal Antibody; ATP5F1D Antibody - middle region; anti-ATP5F1D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAA
Sequence Length
168
Applicable Applications for anti-ATP5F1D antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ATP5D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATP5DSample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATP5DSample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ATP5F1D antibody
This is a rabbit polyclonal antibody against ATP5D. It was validated on Western Blot

Target Description: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified.
Product Categories/Family for anti-ATP5F1D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
513
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
ATP synthase subunit delta, mitochondrial
NCBI Official Synonym Full Names
ATP synthase F1 subunit delta
NCBI Official Symbol
ATP5F1D
NCBI Official Synonym Symbols
ATP5D; MC5DN5
NCBI Protein Information
ATP synthase subunit delta, mitochondrial
UniProt Protein Name
ATP synthase subunit delta, mitochondrial
UniProt Gene Name
ATP5D
UniProt Entry Name
ATPD_HUMAN

NCBI Description

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP5D: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits. Belongs to the ATPase epsilon chain family.

Protein type: Energy Metabolism - oxidative phosphorylation; Hydrolase; Mitochondrial; EC 3.6.3.14

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: mitochondrion; mitochondrial matrix; mitochondrial inner membrane; mitochondrial proton-transporting ATP synthase complex

Molecular Function: transporter activity; ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; transmembrane transporter activity; ADP binding; hydrogen ion transporting ATPase activity, rotational mechanism; ATP binding

Biological Process: cellular metabolic process; ATP synthesis coupled proton transport; response to copper ion; ATP biosynthetic process; mitochondrial ATP synthesis coupled proton transport; oxidative phosphorylation

Research Articles on ATP5F1D

Similar Products

Product Notes

The ATP5F1D atp5d (Catalog #AAA3219406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP5F1D Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5F1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP5F1D atp5d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPGLVVVHAE DGTTSKYFVS SGSIAVNADS SVQLLAEEAV TLDMLDLGAA. It is sometimes possible for the material contained within the vial of "ATP5F1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.