Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence-ATM Polyclonal Antibody)

Rabbit anti-Human, Rat ATM Polyclonal Antibody | anti-ATM antibody

ATM Polyclonal Antibody

Gene Names
ATM; AT1; ATA; ATC; ATD; ATE; ATDC; TEL1; TELO1
Reactivity
Human, Rat
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
ATM; Polyclonal Antibody; ATM Polyclonal Antibody; AT1; ATA; ATC; ATD; ATDC; ATE; TEL1; TELO1; serine-protein kinase ATM; anti-ATM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.44 mg/ml (varies by lot)
Sequence Length
1708
Applicable Applications for anti-ATM antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human ATM (NP_000042.3).
Immunogen Sequence
CLDKKSQRTMLAVVDYMRRQKRPSSGTIFNDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRSLAFEEGSQSTTISSLSEKSKEETGIS
Cellular Location
Cytoplasmic Vesicle, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence-ATM Polyclonal Antibody)

Immunofluorescence (IF) (Immunofluorescence-ATM Polyclonal Antibody)
Related Product Information for anti-ATM antibody
The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates; thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
472
UniProt Accession #
Molecular Weight
350kDa
NCBI Official Full Name
Ataxia telangiectasia mutated
NCBI Official Synonym Full Names
ATM serine/threonine kinase
NCBI Official Symbol
ATM
NCBI Official Synonym Symbols
AT1; ATA; ATC; ATD; ATE; ATDC; TEL1; TELO1
NCBI Protein Information
serine-protein kinase ATM
UniProt Protein Name
Serine-protein kinase ATM
Protein Family
UniProt Gene Name
ATM
UniProt Synonym Gene Names
A-T mutated
UniProt Entry Name
ATM_HUMAN

NCBI Description

The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates; thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder. [provided by RefSeq, Aug 2010]

Uniprot Description

ATM: an atypical kinase of the PIKK family. Regulates cell cycle checkpoints and DNA repair . May function as a tumor suppressor. Activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Involved in the activation of ABL1 and SAPK. Binds DNA ends and is part of the BRCA1- associated genome surveillance complex (BASC), which contains BRCA1, MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the RAD50-MRE11-NBN protein complex. This association could be a dynamic process changing throughout the cell cycle and within subnuclear domains. DNA damage promotes association with RAD17. LOF mutations associated with ataxia telangiectasia, causing progressive loss of motor control (ataxia), dilation of superficial blood vessels (telangiectasia), cancer and immune deficiency. Approximately 30% of cases develop tumors, mostly lymphomas and leukemias, due to defects in DNA damage repair. Somatic mutations seen in leukemias and lymphomas.

Protein type: Tumor suppressor; Protein kinase, Ser/Thr (non-receptor); Protein kinase, atypical; DNA repair, damage; Kinase, protein; EC 2.7.11.1; ATYPICAL group; PIKK family

Chromosomal Location of Human Ortholog: 11q22-q23

Cellular Component: nucleoplasm; chromosome, telomeric region; cytoplasmic membrane-bound vesicle; spindle

Molecular Function: protein dimerization activity; protein serine/threonine kinase activity; protein binding; DNA binding; 1-phosphatidylinositol-3-kinase activity; protein complex binding; protein N-terminus binding; DNA-dependent protein kinase activity; histone serine kinase activity; ATP binding

Biological Process: lipoprotein catabolic process; DNA damage induced protein phosphorylation; positive regulation of apoptosis; heart development; protein amino acid autophosphorylation; pre-B cell allelic exclusion; negative regulation of B cell proliferation; signal transduction; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; protein amino acid phosphorylation; positive regulation of neuron apoptosis; double-strand break repair; mitotic cell cycle spindle assembly checkpoint; cell cycle arrest; telomere maintenance; somitogenesis; V(D)J recombination; DNA repair; double-strand break repair via homologous recombination; neuron apoptosis; peptidyl-serine phosphorylation; DNA damage response, signal transduction resulting in induction of apoptosis; meiotic recombination; response to hypoxia; response to ionizing radiation; brain development; positive regulation of DNA damage response, signal transduction by p53 class mediator; response to DNA damage stimulus; oocyte development

Disease: Breast Cancer; Ataxia-telangiectasia

Research Articles on ATM

Similar Products

Product Notes

The ATM atm (Catalog #AAA9140401) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATM Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATM can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50-1:200. Researchers should empirically determine the suitability of the ATM atm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.