Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Rat testis, using ATG12 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Rabbit anti-Rat ATG12 Polyclonal Antibody | anti-ATG12 antibody

ATG12 Rabbit pAb

Gene Names
ATG12; APG12; FBR93; APG12L; HAPG12
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
ATG12; Polyclonal Antibody; ATG12 Rabbit pAb; APG12; APG12L; FBR93; HAPG12; Apg12; anti-ATG12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL
Applicable Applications for anti-ATG12 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-74 of human ATG12 (NP_001264712.1).
Cellular Location
Cytoplasm, Peripheral membrane protein, Preautophagosomal structure membrane
Positive Samples
Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Rat testis, using ATG12 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Western Blot (WB) (Western blot analysis of extracts of Rat testis, using ATG12 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-ATG12 antibody
Background: Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).
Product Categories/Family for anti-ATG12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
7,746 Da
NCBI Official Full Name
ATG12 autophagy related 12 homolog (S. cerevisiae), isoform CRA_b
NCBI Official Synonym Full Names
autophagy related 12
NCBI Official Symbol
ATG12
NCBI Official Synonym Symbols
APG12; FBR93; APG12L; HAPG12
NCBI Protein Information
ubiquitin-like protein ATG12; Apg12 (autophagy, yeast) homolog; ATG12 autophagy related 12 homolog
UniProt Protein Name
Ubiquitin-like protein ATG12
Protein Family
UniProt Gene Name
ATG12
UniProt Synonym Gene Names
APG12; APG12L; APG12-like
UniProt Entry Name
ATG12_HUMAN

NCBI Description

Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).[supplied by OMIM, Mar 2008]

Uniprot Description

ATG12: Ubiquitin-like protein required for autophagy. Conjugated to ATG3 and ATG5. Ubiquitous. Belongs to the ATG12 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy; Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 5q21-q22

Cellular Component: pre-autophagosomal structure membrane

Molecular Function: protein binding; APG8 conjugating enzyme activity

Biological Process: mitochondrion degradation; innate immune response; C-terminal protein lipidation; negative regulation of interferon type I production; cellular response to nitrogen starvation; autophagic vacuole formation

Research Articles on ATG12

Similar Products

Product Notes

The ATG12 atg12 (Catalog #AAA9142591) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG12 Rabbit pAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATG12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ATG12 atg12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEEPQSVLQ LPTSIAAGGE GLTDVSPETT TPEPPSSAAV SPGTEEPAGD TKKKIYLCES VLCSFPRPRS WNSL. It is sometimes possible for the material contained within the vial of "ATG12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.