Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATG101Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ATG101 Polyclonal Antibody | anti-ATG101 antibody

ATG101 Antibody - N-terminal region

Gene Names
ATG101; C12orf44
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATG101; Polyclonal Antibody; ATG101 Antibody - N-terminal region; anti-ATG101 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTV
Sequence Length
218
Applicable Applications for anti-ATG101 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATG101
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATG101Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATG101Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-ATG101 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
autophagy-related protein 101
NCBI Official Synonym Full Names
autophagy related 101
NCBI Official Symbol
ATG101
NCBI Official Synonym Symbols
C12orf44
NCBI Protein Information
autophagy-related protein 101
UniProt Protein Name
Autophagy-related protein 101
Protein Family
UniProt Gene Name
ATG101
UniProt Synonym Gene Names
C12orf44
UniProt Entry Name
ATGA1_HUMAN

Uniprot Description

ATG101: an protein required for autophagosome formation. Interacts with ATG13. Associates with a complex composed of ATG13, ULK1 and RB1CC1. Under starvation conditions it localizes to phagophores, which are preautophagosomal structures. Stabilizes the expression of Atg13 in the cell. Belongs to the ATG101 family.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 12q13.13

Molecular Function: identical protein binding; protein binding; protein complex binding

Biological Process: autophagic vacuole formation

Research Articles on ATG101

Similar Products

Product Notes

The ATG101 atg101 (Catalog #AAA3220959) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG101 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG101 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATG101 atg101 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNCRSEVLEV SVEGRQVEEA MLAVLHTVLL HRSTGKFHYK KEGTYSIGTV. It is sometimes possible for the material contained within the vial of "ATG101, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.