Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ASZ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Rabbit anti-Mouse, Rat ASZ1 Polyclonal Antibody | anti-ASZ1 antibody
ASZ1 Polyclonal Antibody
Gene Names
ASZ1; ALP1; GASZ; Orf3; ANKL1; C7orf7; CT1.19
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ASZ1; Polyclonal Antibody; ASZ1 Polyclonal Antibody; ALP1; ANKL1; C7orf7; CT1.19; GASZ; Orf3; anti-ASZ1 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTIC
Sequence Length
466
Applicable Applications for anti-ASZ1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human ASZ1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ASZ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using ASZ1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Product Categories/Family for anti-ASZ1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 52kDa; 53kDa
Observed: 50kDa
Observed: 50kDa
NCBI Official Full Name
ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 isoform 2
NCBI Official Synonym Full Names
ankyrin repeat, SAM and basic leucine zipper domain containing 1
NCBI Official Symbol
ASZ1
NCBI Official Synonym Symbols
ALP1; GASZ; Orf3; ANKL1; C7orf7; CT1.19
NCBI Protein Information
ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
UniProt Protein Name
Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
UniProt Gene Name
ASZ1
Uniprot Description
Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in the regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation ().
Research Articles on ASZ1
Similar Products
Product Notes
The ASZ1 asz1 (Catalog #AAA9134450) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASZ1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ASZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ASZ1 asz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAASALRGLP VAGGGESSES EDDGWEIGYL DRTSQKLKRL LPIEEKKEKF KKAMTIGDVS LVQELLDSGI SVDSNFQYGW TPLMYAASVA NAELVRVLLD RGANASFEKD KQSILITACS AHGSEEQILK CVELLLSRNA DPNVACRRLM TPIMYAARDG HTQVVALLVA HGAEVNTQDE NGYTALTWAA RQGHKNIVLK LLELGANKML QTKDGKMPSE IAKRNKHHEI FNLLSFTLNP LEGKLQQLTK EDTIC. It is sometimes possible for the material contained within the vial of "ASZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
