Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ASPSCR1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ASPSCR1 Polyclonal Antibody | anti-ASPSCR1 antibody

ASPSCR1 Antibody - middle region

Gene Names
ASPSCR1; TUG; ASPL; ASPS; RCC17; UBXD9; UBXN9; ASPCR1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ASPSCR1; Polyclonal Antibody; ASPSCR1 Antibody - middle region; anti-ASPSCR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQGFFRPSETVGDLRDFVRSHLGNPELSFYLFITPPKTVLDDHTQTLFQA
Sequence Length
647
Applicable Applications for anti-ASPSCR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ASPSCR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ASPSCR1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ASPSCR1Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ASPSCR1 antibody
The protein encoded by this gene contains a UBX domain and interacts with glucose transporter type 4 (GLUT4). This protein is a tether, which sequesters the GLUT4 in intracellular vesicles in muscle and fat cells in the absence of insulin, and redistributes the GLUT4 to the plasma membrane within minutes of insulin stimulation. Translocation t(X;17)(p11;q25) of this gene with transcription factor TFE3 gene results in a ASPSCR1-TFE3 fusion protein in alveolar soft part sarcoma and in renal cell carcinomas. Multiple alternatively spliced transcript variants have been found.
Product Categories/Family for anti-ASPSCR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71 kDa
NCBI Official Full Name
tether containing UBX domain for GLUT4 isoform 2
NCBI Official Synonym Full Names
ASPSCR1 tether for SLC2A4, UBX domain containing
NCBI Official Symbol
ASPSCR1
NCBI Official Synonym Symbols
TUG; ASPL; ASPS; RCC17; UBXD9; UBXN9; ASPCR1
NCBI Protein Information
tether containing UBX domain for GLUT4
UniProt Protein Name
Tether containing UBX domain for GLUT4
UniProt Gene Name
ASPSCR1
UniProt Synonym Gene Names
ASPL; RCC17; TUG; UBXD9; UBXN9
UniProt Entry Name
ASPC1_HUMAN

NCBI Description

The protein encoded by this gene contains a UBX domain and interacts with glucose transporter type 4 (GLUT4). This protein is a tether, which sequesters the GLUT4 in intracellular vesicles in muscle and fat cells in the absence of insulin, and redistributes the GLUT4 to the plasma membrane within minutes of insulin stimulation. Translocation t(X;17)(p11;q25) of this gene with transcription factor TFE3 gene results in a ASPSCR1-TFE3 fusion protein in alveolar soft part sarcoma and in renal cell carcinomas. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Oct 2011]

Uniprot Description

ASPSCR1: Tethering protein that sequesters GLUT4-containing vesicles in the cytoplasm in the absence of insulin. Modulates the amount of GLUT4 that is available at the cell surface. Interacts with GLUT4. Ubiquitous. Highly expressed in testis, heart, skeletal muscle and pancreas. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, peripheral; Vesicle; Oncoprotein

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: nucleoplasm; internal side of plasma membrane; ER-Golgi intermediate compartment membrane; extrinsic to membrane; intracellular membrane-bound organelle; perinuclear region of cytoplasm; plasma membrane; endomembrane system; vesicle membrane; cytosol

Molecular Function: protein binding

Biological Process: intracellular protein transport; regulation of glucose import; glucose homeostasis

Disease: Alveolar Soft Part Sarcoma

Research Articles on ASPSCR1

Similar Products

Product Notes

The ASPSCR1 aspscr1 (Catalog #AAA3222509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASPSCR1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASPSCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASPSCR1 aspscr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQGFFRPSET VGDLRDFVRS HLGNPELSFY LFITPPKTVL DDHTQTLFQA. It is sometimes possible for the material contained within the vial of "ASPSCR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.