Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- ASPH Picoband antibody, MBS177861, Western blottingAll lanes: Anti ASPH (MBS177861) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 86KDObserved bind size: 100KD )

ASPH Polyclonal Antibody | anti-ASPH antibody

Anti-ASPH Antibody

Gene Names
ASPH; AAH; BAH; HAAH; JCTN; FDLAB; junctin; CASQ2BP1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
ASPH; Polyclonal Antibody; Anti-ASPH Antibody; Aspartyl/asparaginyl beta-hydroxylase; A beta H J J; AAH; ASP beta hydroxylase; Aspartyl/asparaginyl beta hydroxylase; ASPH_HUMAN; BAH; Cardiac junctin; CASQ2BP1; HAAH; Humbug; JCTN; junctin; Peptide aspartate beta dioxygenase; aspartate beta-hydroxylase; anti-ASPH antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
729
Applicable Applications for anti-ASPH antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- ASPH Picoband antibody, MBS177861, Western blottingAll lanes: Anti ASPH (MBS177861) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 86KDObserved bind size: 100KD )

Western Blot (WB) (Anti- ASPH Picoband antibody, MBS177861, Western blottingAll lanes: Anti ASPH (MBS177861) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 86KDObserved bind size: 100KD )

Immunohistochemistry (IHC)

(Anti- ASPH Picoband antibody, MBS177861,IHC(P)IHC(P): Human Mammary Cancer Tissue )

Immunohistochemistry (IHC) (Anti- ASPH Picoband antibody, MBS177861,IHC(P)IHC(P): Human Mammary Cancer Tissue )
Related Product Information for anti-ASPH antibody
Description: Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.
References
1. "Entrez Gene: ASPH aspartate beta-hydroxylase". 2. Korioth F, Gieffers C, Frey J (Feb 1995). "Cloning and characterization of the human gene encoding aspartyl beta-hydroxylase". Gene 150 (2): 395-9. 3. Lim KY, Hong CS, Kim DH (Nov 2000). "cDNA cloning and characterization of human cardiac junctin". Gene 255 (1): 35-42.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
444
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,926 Da
NCBI Official Full Name
aspartyl/asparaginyl beta-hydroxylase isoform f
NCBI Official Synonym Full Names
aspartate beta-hydroxylase
NCBI Official Symbol
ASPH
NCBI Official Synonym Symbols
AAH; BAH; HAAH; JCTN; FDLAB; junctin; CASQ2BP1
NCBI Protein Information
aspartyl/asparaginyl beta-hydroxylase
UniProt Protein Name
Aspartyl/asparaginyl beta-hydroxylase
UniProt Gene Name
ASPH
UniProt Synonym Gene Names
BAH; ASP beta-hydroxylase
UniProt Entry Name
ASPH_HUMAN

NCBI Description

This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009]

Uniprot Description

ASPH: Isoform 1: specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins. Belongs to the aspartyl/asparaginyl beta-hydroxylase family. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.14.11.16; Oxidoreductase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to membrane; plasma membrane; sarcoplasmic reticulum lumen; sarcoplasmic reticulum membrane

Molecular Function: calcium ion binding; electron carrier activity; peptide-aspartate beta-dioxygenase activity; protein binding; structural constituent of muscle; structural molecule activity

Biological Process: activation of store-operated calcium channel activity; detection of calcium ion; limb morphogenesis; muscle contraction; negative regulation of cell proliferation; palate development; pattern specification process; peptidyl-aspartic acid hydroxylation; positive regulation of proteolysis; positive regulation of transcription, DNA-dependent; regulation of inositol-1,4,5-triphosphate receptor activity; regulation of protein stability; response to ATP

Research Articles on ASPH

Similar Products

Product Notes

The ASPH asph (Catalog #AAA177861) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ASPH Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ASPH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the ASPH asph for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASPH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.