Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ASCL4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 5s.)

Rabbit anti-Human ASCL4 Polyclonal Antibody | anti-ASCL4 antibody

ASCL4 Polyclonal Antibody

Gene Names
ASCL4; HASH4; bHLHa44
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ASCL4; Polyclonal Antibody; ASCL4 Polyclonal Antibody; bHLHa44; HASH4; anti-ASCL4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MMETRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGG
Sequence Length
173
Applicable Applications for anti-ASCL4 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human ASCL4
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
A431, A549, SGC-7901, 293T, MCF7
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ASCL4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 5s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ASCL4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 5s.)
Product Categories/Family for anti-ASCL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 19kDa
Observed: 19kDa
NCBI Official Full Name
achaete-scute homolog 4
NCBI Official Synonym Full Names
achaete-scute family bHLH transcription factor 4
NCBI Official Symbol
ASCL4
NCBI Official Synonym Symbols
HASH4; bHLHa44
NCBI Protein Information
achaete-scute homolog 4
UniProt Protein Name
Achaete-scute homolog 4
Protein Family
UniProt Gene Name
ASCL4
UniProt Synonym Gene Names
BHLHA44; HASH4; ASH-4; hASH4; bHLHa44

NCBI Description

Basic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]

Uniprot Description

Could be a transcriptional regulator involved in skin development.

Research Articles on ASCL4

Similar Products

Product Notes

The ASCL4 ascl4 (Catalog #AAA9134442) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASCL4 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASCL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ASCL4 ascl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMETRKPAER LALPYSLRTA PLGVPGTLPG LPRRDPLRVA LRLDAACWEW ARSGCARGWQ YLPVPLDSAF EPAFLRKRNE RERQRVRCVN EGYARLRDHL PRELADKRLS KVETLRAAID YIKHLQELLE RQAWGLEGAA GAVPQRRAEC NSDGESKASS APSPSSEPEE GG. It is sometimes possible for the material contained within the vial of "ASCL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.