Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ASCL2 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Human Small intestine)

Rabbit ASCL2 Polyclonal Antibody | anti-ASCL2 antibody

ASCL2 antibody - middle region

Gene Names
Ascl2; Mash2; bHLHa45; 2410083I15Rik
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ASCL2; Polyclonal Antibody; ASCL2 antibody - middle region; anti-ASCL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYI
Sequence Length
263
Applicable Applications for anti-ASCL2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 93%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ASCL2 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Human Small intestine)

Western Blot (WB) (WB Suggested Anti-ASCL2 Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Human Small intestine)
Related Product Information for anti-ASCL2 antibody
This is a rabbit polyclonal antibody against ASCL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Mouse ASCL2 is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It is the first transcription factor shown to play a critical part in the development of the mammalian trophoblast lineage.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
achaete-scute homolog 2
NCBI Official Synonym Full Names
achaete-scute family bHLH transcription factor 2
NCBI Official Symbol
Ascl2
NCBI Official Synonym Symbols
Mash2; bHLHa45; 2410083I15Rik
NCBI Protein Information
achaete-scute homolog 2
UniProt Protein Name
Achaete-scute homolog 2
Protein Family
UniProt Gene Name
Ascl2
UniProt Synonym Gene Names
Mash2; ASH-2; mASH-2; mASH2

Uniprot Description

ASCL2: a basic helix-loop-helix transcription factor, plays an essential role in the maintenance of adult intestinal stem cells

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 7 F5|7 88.08 cM

Cellular Component: cytoplasm; nucleus

Molecular Function: DNA binding; DNA binding transcription factor activity; protein dimerization activity; sequence-specific DNA binding

Biological Process: cell differentiation; in utero embryonic development; multicellular organism development; negative regulation of transcription from RNA polymerase II promoter; nervous system development; placenta development; regulation of neurogenesis; regulation of transcription from RNA polymerase II promoter; somatic stem cell maintenance; transcription, DNA-dependent

Research Articles on ASCL2

Similar Products

Product Notes

The ASCL2 ascl2 (Catalog #AAA3203366) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASCL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ASCL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASCL2 ascl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAVARRNERE RNRVKLVNLG FQALRQHVPH GGANKKLSKV ETLRSAVEYI. It is sometimes possible for the material contained within the vial of "ASCL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.