Western Blot (WB)
(WB Suggested Anti-ARV1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
Rabbit ARV1 Polyclonal Antibody | anti-ARV1 antibody
ARV1 antibody - middle region
Gene Names
ARV1; EIEE38
Reactivity
Cow, Dog, Goat, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARV1; Polyclonal Antibody; ARV1 antibody - middle region; anti-ARV1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
Sequence Length
271
Applicable Applications for anti-ARV1 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 79%; Goat: 85%; Human: 100%; Pig: 85%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARV1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ARV1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ARV1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-ARV1 antibody
This is a rabbit polyclonal antibody against ARV1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ARV1 may act as a mediator of sterol homeostasis.
Target Description: ARV1 may act as a mediator of sterol homeostasis.
Product Categories/Family for anti-ARV1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
protein ARV1 isoform 2
NCBI Official Synonym Full Names
ARV1 homolog, fatty acid homeostasis modulator
NCBI Official Symbol
ARV1
NCBI Official Synonym Symbols
EIEE38
NCBI Protein Information
protein ARV1
UniProt Protein Name
Protein ARV1
Protein Family
UniProt Gene Name
ARV1
UniProt Synonym Gene Names
hARV1
UniProt Entry Name
ARV1_HUMAN
NCBI Description
this gene encodes a transmembrane protein that contains a conserved zinc ribbon motif at the N- terminus. A similar protein in mouse is thought to function in fatty acid homeostasis. Mutations in this gene are associated with early infantile epileptic encephalopathy 38. [provided by RefSeq, Nov 2016]
Research Articles on ARV1
Similar Products
Product Notes
The ARV1 arv1 (Catalog #AAA3209611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARV1 antibody - middle region reacts with Cow, Dog, Goat, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ARV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARV1 arv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAIRVTLNIN RKLSFLAVLS GLLLESIMVY FFQSMEWDVG SDYAIFKSQD. It is sometimes possible for the material contained within the vial of "ARV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
