Immunohistochemistry (IHC)
(Human Skin )
Rabbit ARNTL Polyclonal Antibody | anti-ARNTL antibody
ARNTL antibody - N-terminal region
Gene Names
ARNTL; TIC; JAP3; MOP3; BMAL1; PASD3; BMAL1c; bHLHe5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ARNTL; Polyclonal Antibody; ARNTL antibody - N-terminal region; anti-ARNTL antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
Sequence Length
625
Applicable Applications for anti-ARNTL antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ARNTL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Skin )
Immunohistochemistry (IHC)
(Human Skin )
Western Blot (WB)
(Host: MouseTarget Name: ARNTLSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: ARNTLSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-ARNTL Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ARNTL Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ARNTL antibody
This is a rabbit polyclonal antibody against ARNTL. It was validated on Western Blot and immunohistochemistry
Target Description: ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators.
Target Description: ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators.
Product Categories/Family for anti-ARNTL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
aryl hydrocarbon receptor nuclear translocator-like protein 1 isoform a
NCBI Official Synonym Full Names
aryl hydrocarbon receptor nuclear translocator like
NCBI Official Symbol
ARNTL
NCBI Official Synonym Symbols
TIC; JAP3; MOP3; BMAL1; PASD3; BMAL1c; bHLHe5
NCBI Protein Information
aryl hydrocarbon receptor nuclear translocator-like protein 1
UniProt Protein Name
Aryl hydrocarbon receptor nuclear translocator-like protein 1
Protein Family
UniProt Gene Name
ARNTL
UniProt Synonym Gene Names
BHLHE5; BMAL1; MOP3; PASD3; bHLHe5
UniProt Entry Name
BMAL1_HUMAN
NCBI Description
The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Research Articles on ARNTL
Similar Products
Product Notes
The ARNTL arntl (Catalog #AAA3200699) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARNTL antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ARNTL can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ARNTL arntl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDYQESMDTD KDDPHGRLEY TEHQGRIKNA REAHSQIEKR RRDKMNSF. It is sometimes possible for the material contained within the vial of "ARNTL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
