Western Blot (WB)
(WB Suggested Anti-ARMC4 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Rabbit ARMC4 Polyclonal Antibody | anti-ARMC4 antibody
ARMC4 antibody - N-terminal region
Gene Names
ARMC4; CILD23
Reactivity
Cow, Dog, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARMC4; Polyclonal Antibody; ARMC4 antibody - N-terminal region; anti-ARMC4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLSVPQIKIRSFGQLSR
Sequence Length
1044
Applicable Applications for anti-ARMC4 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 93%; Horse: 100%; Human: 100%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ARMC4 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Western Blot (WB)
(WB Suggested Anti-ARMC4 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-ARMC4 antibody
This is a rabbit polyclonal antibody against ARMC4. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-ARMC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa
NCBI Official Full Name
armadillo repeat-containing protein 4 isoform 1
NCBI Official Synonym Full Names
armadillo repeat containing 4
NCBI Official Symbol
ARMC4
NCBI Official Synonym Symbols
CILD23
NCBI Protein Information
armadillo repeat-containing protein 4
UniProt Protein Name
Armadillo repeat-containing protein 4
Protein Family
UniProt Gene Name
ARMC4
UniProt Entry Name
ARMC4_HUMAN
NCBI Description
The protein encoded by this gene contains ten Armadillo repeat motifs (ARMs) and one HEAT repeat, and is thought to be involved in ciliary and flagellar movement. This protein has been shown to localize to the ciliary axonemes and at the ciliary base of respiratory cells. Studies indicate that mutations in this gene cause partial outer dynein arm (ODA) defects in respiratory cilia. The cilia of cells with mutations in this gene displayed either reduced ciliary beat frequency and amplitude, or, complete immotility. Some individuals with primary ciliary dyskensia (PCD) have been shown to have mutations in this gene. PCD is characterized by chronic airway disease and left/right body asymmetry defects. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]
Research Articles on ARMC4
Similar Products
Product Notes
The ARMC4 armc4 (Catalog #AAA3213963) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARMC4 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARMC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARMC4 armc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NTSLAPSAFE SGYVVSETTV KSEEVDKNGQ PLLFLSVPQI KIRSFGQLSR. It is sometimes possible for the material contained within the vial of "ARMC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
