Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- ARID1A Picoband antibody, MBS177708, Western blottingAll lanes: Anti ARID1A (MBS177708) at 0.5ug/mlLane 1: SW620 Whole Cell Lysate at 40ugLane 2: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 242KDObserved bind size: 242KD )

anti-Human ARID1A Polyclonal Antibody | anti-ARID1A antibody

Anti-ARID1A Antibody

Gene Names
ARID1A; ELD; B120; CSS2; OSA1; P270; hELD; BM029; MRD14; hOSA1; BAF250; C1orf4; BAF250a; SMARCF1
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ARID1A; Polyclonal Antibody; Anti-ARID1A Antibody; AT-rich interactive domain-containing protein 1A; actin-dependent regulator of chromatin subfamily F member 1; ARI1A_HUMAN; ARID domain containing protein 1A; ARID domain-containing protein 1A; AT rich interactive domain 1A (SWI like); AT rich interactive domain 1A; AT rich interactive domain containing protein 1A; B120; BAF250; BAF250A; BM029; brain protein 120; BRG1 associated factor 250; BRG1 associated factor 250a; BRG1-associated factor 250; BRG1-associated factor 250a; C1ORF4; chromatin remodeling factor p250; chromosome 1 open reading frame 4; hELD; hOSA1; matrix-associated; Osa homolog 1; OSA1; OSA1 nuclear protein; P270; SMARCF1; SWI like protein; SWI SNF complex protein p270; SWI-like protein; SWI/SNF complex protein p270; SWI/SNF related; matrix associated; actin dependent regulator of chromatin; subfamily f; member 1; SWI/SNF-related antibody; AT rich interactive domain 1A (SWI-like); anti-ARID1A antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
2285
Applicable Applications for anti-ARID1A antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- ARID1A Picoband antibody, MBS177708, Western blottingAll lanes: Anti ARID1A (MBS177708) at 0.5ug/mlLane 1: SW620 Whole Cell Lysate at 40ugLane 2: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 242KDObserved bind size: 242KD )

Western Blot (WB) (Anti- ARID1A Picoband antibody, MBS177708, Western blottingAll lanes: Anti ARID1A (MBS177708) at 0.5ug/mlLane 1: SW620 Whole Cell Lysate at 40ugLane 2: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 242KDObserved bind size: 242KD )
Related Product Information for anti-ARID1A antibody
Description: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human.

Background: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.
References
1. Dallas, P. B., Pacchione, S., Wilsker, D., Bowrin, V., Kobayashi, R., Moran, E. The human SWI-SNF complex protein p270 is an ARID family member with non-sequence-specific DNA binding activity. Molec. Cell. Biol. 20: 3137-3146, 2000. 2. Krosl, J., Mamo, A., Chagraoui, J., Wilhelm, B. T., Girard, S., Louis, I., Lessard, J., Perreault, C., Sauvageau, G. A mutant allele of the Swi/Snf member BAF250a determines the pool size of fetal liver hemopoietic stem cell populations. Blood 116: 1678-1684, 2010. 3. Nie, Z., Xue, Y., Yang, D., Zhou, S., Deroo, B. J., Archer, T. K., Wang, W. A specificity and targeting subunit of a human SWI/SNF family-related chromatin-remodeling complex. Molec. Cell. Biol. 20: 8879-8888, 2000.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
205,921 Da
NCBI Official Full Name
AT-rich interactive domain-containing protein 1A isoform a
NCBI Official Synonym Full Names
AT-rich interaction domain 1A
NCBI Official Symbol
ARID1A
NCBI Official Synonym Symbols
ELD; B120; CSS2; OSA1; P270; hELD; BM029; MRD14; hOSA1; BAF250; C1orf4; BAF250a; SMARCF1
NCBI Protein Information
AT-rich interactive domain-containing protein 1A
UniProt Protein Name
AT-rich interactive domain-containing protein 1A
UniProt Gene Name
ARID1A
UniProt Synonym Gene Names
BAF250; BAF250A; C1orf4; OSA1; SMARCF1; ARID domain-containing protein 1A; BAF250; BAF250A; hOSA1
UniProt Entry Name
ARI1A_HUMAN

NCBI Description

This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ARID1A: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Binds DNA non-specifically. Also involved in vitamin D- coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR- mediated transrepression of the CYP27B1 gene. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Defects in ARID1A are the cause of mental retardation autosomal dominant type 14 (MRD14). A disease characterized by multiple congenital anomalies and mental retardation. Mental retardation is defined by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRD14 patients manifest developmental delay, abnormal corpus callosum, absent/hypoplastic fifth finger/toenails, sparse scalp hair, long eyelashes, and a coarse facial appearance with wide mouth, thick lips, and abnormal ears. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; DNA-binding

Chromosomal Location of Human Ortholog: 1p35.3

Cellular Component: nuclear chromatin; nucleoplasm; nucleus; SWI/SNF complex

Molecular Function: DNA binding; ligand-dependent nuclear receptor binding; nucleosome binding; protein binding; transcription coactivator activity

Biological Process: androgen receptor signaling pathway; ATP-dependent chromatin remodeling; cardiac muscle cell differentiation; chromatin remodeling; chromatin-mediated maintenance of transcription; estrogen receptor signaling pathway; forebrain development; glucocorticoid receptor signaling pathway; maintenance of chromatin silencing; negative regulation of transcription from RNA polymerase II promoter; neural tube closure; nucleosome disassembly; nucleosome mobilization; positive regulation of transcription, DNA-dependent; regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent

Disease: Mental Retardation, Autosomal Dominant 14

Research Articles on ARID1A

Similar Products

Product Notes

The ARID1A arid1a (Catalog #AAA177708) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ARID1A Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARID1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ARID1A arid1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARID1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.