Rabbit anti-Human, Mouse ARHGDIB Polyclonal Antibody | anti-ARHGDIB antibody

ARHGDIB (Rho GDP-dissociation Inhibitor 2, Rho GDI 2, Ly-GDI, Rho-GDI beta, GDIA2, GDID4, RAP1GN1) (MaxLight 490)

Cat. Num. AAA6370271

• Gene Names: ARHGDIB; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; RhoGDI2
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ARHGDIB; Polyclonal Antibody; ARHGDIB (Rho GDP-dissociation Inhibitor 2; Rho GDI 2; Ly-GDI; Rho-GDI beta; GDIA2; GDID4; RAP1GN1) (MaxLight 490); anti-ARHGDIB antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ARHGDIB. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-ARHGDIB antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ARHGDIB, aa1-201 (NP_001166.3).
• Immunogen Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
• Conjugate: MaxLight490
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-ARHGDIB antibody

Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.

Product Categories/Family for anti-ARHGDIB antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 56676393
• NCBI GeneID: 397
• NCBI Accession #: NP_001166.3
• NCBI GenBank Nucleotide #: NM_001175
• UniProt Accession #: P52566; B5BU79
• Molecular Weight: 22,988 Da
• NCBI Official Full Name: rho GDP-dissociation inhibitor 2
• NCBI Official Synonym Full Names: Rho GDP dissociation inhibitor (GDI) beta
• NCBI Official Symbol: ARHGDIB
• NCBI Official Synonym Symbols: D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; RhoGDI2
• NCBI Protein Information: rho GDP-dissociation inhibitor 2; Rho GDI 2; rho-GDI beta
• UniProt Protein Name: Rho GDP-dissociation inhibitor 2
• Protein Family: Rho GDP-dissociation inhibitor
• UniProt Gene Name: ARHGDIB
• UniProt Synonym Gene Names: GDIA2; GDID4; RAP1GN1; Rho GDI 2
• UniProt Entry Name: GDIR2_HUMAN

NCBI Description

Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010]

Uniprot Description

RhoGDI beta: regulates the GDP/GTP exchange reaction of Rho proteins by inhibiting the dissociation of GDP from them, keeping these small GTPases in an inactive state. The GDIs are made up of two domains: a flexible N-terminal domain of about 70 amino acid residues and a folded 134-residue C-terminal domain. Regulates the GTP/GDP cycling of glucose-responsive small GTPases. Its phosphorylation on Y156, S101, and S174 mediates the cycling of Cdc42 and Rac1 to regulate second-phase insulin secretion. Interacts with WNK1.

Protein type: G protein regulator, misc.; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12p12.3

Cellular Component: cytoskeleton; cytoplasm; cytoplasmic membrane-bound vesicle; cytosol

Molecular Function: Rho GDP-dissociation inhibitor activity; GTPase activator activity

Biological Process: regulation of small GTPase mediated signal transduction; regulation of catalytic activity; small GTPase mediated signal transduction; multicellular organismal development; immune response; negative regulation of cell adhesion; cell motility; actin cytoskeleton organization and biogenesis; Rho protein signal transduction; positive regulation of GTPase activity