Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ARHGAP11B antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 2s.)

Rabbit anti-Human ARHGAP11B Polyclonal Antibody | anti-ARHGAP11B antibody

ARHGAP11B Rabbit pAb

Gene Names
ARHGAP11B; B'-T; FAM7B1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
ARHGAP11B; Polyclonal Antibody; ARHGAP11B Rabbit pAb; FAM7B1; anti-ARHGAP11B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV
Applicable Applications for anti-ARHGAP11B antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 218-267 of human ARHGAP11B (NP_001034930.1).
Positive Samples
SH-SY5Y, U-251MG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ARHGAP11B antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 2s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ARHGAP11B antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 2s.)
Product Categories/Family for anti-ARHGAP11B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,251 Da
NCBI Official Full Name
rho GTPase-activating protein 11B
NCBI Official Synonym Full Names
Rho GTPase activating protein 11B
NCBI Official Symbol
ARHGAP11B
NCBI Official Synonym Symbols
B'-T; FAM7B1
NCBI Protein Information
rho GTPase-activating protein 11B; GAP (1-8); rho-type GTPase-activating protein 11B; family with sequence similarity 7, member B1
UniProt Protein Name
Rho GTPase-activating protein 11B
UniProt Gene Name
ARHGAP11B
UniProt Entry Name
RHGBB_HUMAN

Similar Products

Product Notes

The ARHGAP11B arhgap11b (Catalog #AAA9142371) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARHGAP11B Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGAP11B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ARHGAP11B arhgap11b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKKGVYQTLS WKRYQPCWVL MVSVLLHHWK ALKKVNMKLL VNIREREDNV. It is sometimes possible for the material contained within the vial of "ARHGAP11B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.