Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ARFGAP3 AntibodyTitration: 0.125 ug/mlPositive Control: Fetal Lung)

Rabbit ARFGAP3 Polyclonal Antibody | anti-ARFGAP3 antibody

ARFGAP3 antibody - C-terminal region

Gene Names
ARFGAP3; ARFGAP1
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARFGAP3; Polyclonal Antibody; ARFGAP3 antibody - C-terminal region; anti-ARFGAP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKKFGNVKA
Sequence Length
516
Applicable Applications for anti-ARFGAP3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Pig: 79%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ARFGAP3 AntibodyTitration: 0.125 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-ARFGAP3 AntibodyTitration: 0.125 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-ARFGAP3 antibody
This is a rabbit polyclonal antibody against ARFGAP3. It was validated on Western Blot

Target Description: The protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene.
Product Categories/Family for anti-ARFGAP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
ADP-ribosylation factor GTPase-activating protein 3 isoform 1
NCBI Official Synonym Full Names
ADP ribosylation factor GTPase activating protein 3
NCBI Official Symbol
ARFGAP3
NCBI Official Synonym Symbols
ARFGAP1
NCBI Protein Information
ADP-ribosylation factor GTPase-activating protein 3
UniProt Protein Name
ADP-ribosylation factor GTPase-activating protein 3
UniProt Gene Name
ARFGAP3
UniProt Synonym Gene Names
ARFGAP1; ARF GAP 3
UniProt Entry Name
ARFG3_HUMAN

NCBI Description

The protein encoded by this gene is a GTPase-activating protein (GAP) that associates with the Golgi apparatus and regulates the early secretory pathway of proteins. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1 (ARF1)-bound GTP, which is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is a prerequisite for the fusion of these vesicles with target compartments. The activity of this protein is sensitive to phospholipids. Multiple transcript variants encoding different isoforms have been found for this gene. This gene was originally known as ARFGAP1, but that is now the name of a related but different gene. [provided by RefSeq, Nov 2008]

Uniprot Description

ARF GAP 3: GTPase-activating protein (GAP) for ADP ribosylation factor 1 (ARF1). Hydrolysis of ARF1-bound GTP may lead to dissociation of coatomer from Golgi-derived membranes to allow fusion with target membranes.

Protein type: GAPs, ARF; GAPs

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: Golgi membrane; Golgi apparatus; membrane; cytoplasm; cytosol

Molecular Function: protein binding; zinc ion binding; protein transporter activity

Biological Process: vesicle-mediated transport; intracellular protein transport; protein secretion; positive regulation of GTPase activity

Research Articles on ARFGAP3

Similar Products

Product Notes

The ARFGAP3 arfgap3 (Catalog #AAA3215375) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARFGAP3 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARFGAP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARFGAP3 arfgap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SYWKKETSKD TETVLKTTGY SDRPTARRKP DYEPVENTDE AQKKFGNVKA. It is sometimes possible for the material contained within the vial of "ARFGAP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.