Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Adrenal tissue at an antibody concentration of 5ug/ml using anti-ARC antibody )

Rabbit ARC Polyclonal Antibody | anti-ARC antibody

ARC antibody - middle region

Gene Names
ARC; hArc; Arg3.1
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ARC; Polyclonal Antibody; ARC antibody - middle region; anti-ARC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF
Sequence Length
396
Applicable Applications for anti-ARC antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Adrenal tissue at an antibody concentration of 5ug/ml using anti-ARC antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Adrenal tissue at an antibody concentration of 5ug/ml using anti-ARC antibody )

Western Blot (WB)

(Host: RabbitTarget Name: ARCSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARCSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ARCSample Type: 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARCSample Type: 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ARCSample Type: 721_BAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARCSample Type: 721_BAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ARCSample Type: HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ARCSample Type: HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ARC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-ARC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-ARC antibody
This is a rabbit polyclonal antibody against ARC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.
Product Categories/Family for anti-ARC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
activity-regulated cytoskeleton-associated protein
NCBI Official Synonym Full Names
activity regulated cytoskeleton associated protein
NCBI Official Symbol
ARC
NCBI Official Synonym Symbols
hArc; Arg3.1
NCBI Protein Information
activity-regulated cytoskeleton-associated protein
UniProt Protein Name
Activity-regulated cytoskeleton-associated protein
Protein Family
UniProt Gene Name
ARC
UniProt Synonym Gene Names
Arg3.1
UniProt Entry Name
ARC_HUMAN

Uniprot Description

ARG3.1: Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. Belongs to the ARC/ARG3.1 family.

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: postsynaptic membrane; cytoplasm; postsynaptic density; acrosome; plasma membrane; dendritic spine; cell junction; endosome; actin cytoskeleton

Biological Process: anterior/posterior pattern formation; cell migration; regulation of cell morphogenesis; cytoskeleton organization and biogenesis; endocytosis; learning; endoderm development; regulation of neuronal synaptic plasticity

Research Articles on ARC

Similar Products

Product Notes

The ARC arc (Catalog #AAA3203187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARC antibody - middle region reacts with Cow, Goat, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARC can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ARC arc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELDLPQKQGE PLDQFLWRKR DLYQTLYVDA DEEEIIQYVV GTLQPKLKRF. It is sometimes possible for the material contained within the vial of "ARC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.