Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AQP9Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human AQP9 Polyclonal Antibody | anti-AQP9 antibody

AQP9 Antibody-middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AQP9; Polyclonal Antibody; AQP9 Antibody-middle region; Aquaporin-9; SSC1; AQP-9; T17287; HsT17287; anti-AQP9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
PYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVI
Applicable Applications for anti-AQP9 antibody
Western Blot (WB)
Protein Size
295 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AQP9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AQP9Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AQP9Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-AQP9 antibody
Description of Target: The aquaporins are a family of water-selective membrane channels. This gene encodes a member of a subset of aquaporins called the aquaglyceroporins. This protein allows passage of a broad range of noncharged solutes and also stimulates urea transport and osmotic water permeability. This protein may also facilitate the uptake of glycerol in hepatic tissue. The encoded protein may also play a role in specialized leukocyte functions such as immunological response and bactericidal activity. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GeneID
366
UniProt Accession #
Molecular Weight
31kDa
UniProt Protein Name
Aquaporin-9
Protein Family
UniProt Gene Name
AQP9
UniProt Synonym Gene Names
SSC1; AQP-9
UniProt Entry Name
AQP9_HUMAN

Uniprot Description

AQP9: Forms a channel with a broad specificity. Mediates passage of a wide variety of non-charged solutes including carbamides, polyols, purines, and pyrimidines in a phloretin- and mercury-sensitive manner, whereas amino acids, cyclic sugars, Na(+), K(+), Cl(-), and deprotonated monocarboxylates are excluded. Also permeable to urea and glycerol. Belongs to the MIP/aquaporin (TC 1.A.8) family.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, aquaporin family; Channel, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q

Cellular Component: intracellular membrane-bound organelle; integral to plasma membrane; basolateral plasma membrane; plasma membrane; integral to membrane

Molecular Function: purine transmembrane transporter activity; water transporter activity; pyrimidine transmembrane transporter activity; amine transmembrane transporter activity; urea transmembrane transporter activity; carboxylic acid transmembrane transporter activity; polyol transmembrane transporter activity; water channel activity; porin activity; glycerol channel activity

Biological Process: polyol transport; glycerol transport; cellular water homeostasis; metabolic process; water transport; amine transport; carboxylic acid transport; excretion; response to osmotic stress; purine transport; response to mercury ion; response to organic substance; water homeostasis; transport; pyrimidine transport; canalicular bile acid transport; immune response; transmembrane transport

Similar Products

Product Notes

The AQP9 aqp9 (Catalog #AAA3249901) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AQP9 Antibody-middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AQP9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AQP9 aqp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PYLSLANAFA DQVVATMILL IIVFAIFDSR NLGAPRGLEP IAIGLLIIVI. It is sometimes possible for the material contained within the vial of "AQP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.